Align PP1069, component of Acidic amino acid uptake porter, AatJMQP (characterized)
to candidate AO353_24425 AO353_24425 amino acid ABC transporter permease
Query= TCDB::Q88NY4 (223 letters) >FitnessBrowser__pseudo3_N2E3:AO353_24425 Length = 221 Score = 123 bits (309), Expect = 2e-33 Identities = 73/221 (33%), Positives = 118/221 (53%), Gaps = 6/221 (2%) Query: 1 MEMDFSEIIPALPALWEGMVMTLKLMVMGVIGGIVLGTILALMRLSSSKLLSNLAGAYVN 60 ME+DFS I AL G+++TLKL + VI G LG ++A+ R S +K++ ++ YV Sbjct: 1 MELDFSVIFDYKAALLFGLLLTLKLTAICVILGCALGFMVAIARSSKNKIIYGISTVYVA 60 Query: 61 YFRSIPLLLVITWFYLAVPFVLRWITGEDTPVGAFTSCVVAFMMFEAAYFCEIVRAGVQS 120 FR P+L+ + W + +P VL + T ++A ++ AA E RA Sbjct: 61 LFRGTPVLIQLFWMFFCLPLVL------GVELSNLTCGIIALTLYMAAITSETFRASFSF 114 Query: 121 ISKGQMGAAQALGMNYAQTMRLIILPQAFRKMTPLLLQQSIILFQDTSLVYTVGLVDFLN 180 +SK Q A ALG+ Y ++LPQA + P LL LF++++LV VG+ D + Sbjct: 115 VSKEQHDAGVALGLTYRVHTLYVLLPQALLRAAPTLLSNCTSLFKESALVSAVGMADLMF 174 Query: 181 SARSNGDIIGRSHEFLIFAGVVYFLISFSASWLVKRLQKRI 221 +++ + G E L A V+YF+I+F + V L+++I Sbjct: 175 VSQNISNRTGHPVELLTAAAVIYFVIAFPITRAVTALERKI 215 Lambda K H 0.330 0.141 0.417 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 122 Number of extensions: 10 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 223 Length of database: 221 Length adjustment: 22 Effective length of query: 201 Effective length of database: 199 Effective search space: 39999 Effective search space used: 39999 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.9 bits) S2: 45 (21.9 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory