Align Extracellular solute-binding protein family 3; Flags: Precursor (characterized, see rationale)
to candidate AO353_17720 AO353_17720 ABC transporter substrate-binding protein
Query= uniprot:B2TBJ6 (286 letters) >FitnessBrowser__pseudo3_N2E3:AO353_17720 Length = 285 Score = 317 bits (811), Expect = 3e-91 Identities = 157/276 (56%), Positives = 195/276 (70%), Gaps = 2/276 (0%) Query: 13 IGAV-LGAAAIFAAPA-QAKDWKTVTIALEGGYAPWNLTLPGGKLGGFEPELVANLCERI 70 +G+V L A + APA QAK+W +V IA EG Y PWN+TLPGGK+GGFEPEL+ +C R+ Sbjct: 8 LGSVALSAMVLACAPALQAKEWTSVNIATEGAYEPWNVTLPGGKIGGFEPELMDIICPRM 67 Query: 71 KLQCNLVAQDWDGMIPGLQAGKFDVLMDAISITPEREKIIAFSKPYAATPATFAVADAKV 130 KL+CN+V Q+WDGMI L AGKFD+LMDAI I ER+K++AFS PYA TPA+F A + Sbjct: 68 KLKCNIVVQNWDGMIASLNAGKFDMLMDAIVINEERQKVMAFSIPYAQTPASFVALKADL 127 Query: 131 LPKAAPGAGVVKLSGDPKADQPTVDALRKQLKGKTIGIQSGTVYTKFINDGFKDIATIRV 190 LP + L D K + V+ LRK LKGKTIGI SGT+YT FI+ FKD+ATIR Sbjct: 128 LPGKTGAEAAITLGTDAKEVRAGVEELRKALKGKTIGIASGTIYTSFIDQNFKDVATIRE 187 Query: 191 YKTSPERDLDLANGRIDASFDDVTYYAANIDKKETASIVMAGPKIGGPIWGPGEGLAFRK 250 Y +S E LDL GRID +FDDVT++ + +DK E + GP I GPIWG GE L FR+ Sbjct: 188 YGSSAEAILDLLAGRIDVAFDDVTFFNSVMDKPENKPLAFTGPVIKGPIWGEGEALGFRQ 247 Query: 251 QDADLKAKFDTAISAALADGTVKKLSNKWFKTDVTP 286 D +LKAKFD A+ A+ADGT+K LS KWFK D+TP Sbjct: 248 TDPELKAKFDAALKEAMADGTIKTLSEKWFKVDLTP 283 Lambda K H 0.316 0.134 0.396 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 258 Number of extensions: 8 Number of successful extensions: 1 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 286 Length of database: 285 Length adjustment: 26 Effective length of query: 260 Effective length of database: 259 Effective search space: 67340 Effective search space used: 67340 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory