Align D-methionine ABC transporter membrane protein, component of L-Histidine uptake porter, MetIQN (characterized)
to candidate AO353_11630 AO353_11630 ABC transporter permease
Query= TCDB::Q9HT69 (225 letters) >FitnessBrowser__pseudo3_N2E3:AO353_11630 Length = 214 Score = 209 bits (532), Expect = 3e-59 Identities = 100/206 (48%), Positives = 144/206 (69%), Gaps = 1/206 (0%) Query: 14 WYEIWLASV-DTFWMLGGSLLFTVVLGLPLGVLLFLTGPRQMFEQKAVYTLLSLVVNILR 72 W++ L V DTF M+G S L ++ G+PL V+L + ++E A+ L VN+ R Sbjct: 2 WFDRLLQGVIDTFLMVGVSSLIALLAGIPLAVILVTSSKGGIYEAPALNRALGAFVNLFR 61 Query: 73 SLPFIILLIVMIPLTVLITGTSLGVAGAIPPLVVGATPFFARLVETALREVDKGIIEATQ 132 S+PF+IL++ +IP T LI GT+ GV A+ PL + ATPFFAR+ E +LREVD G+IEA Q Sbjct: 62 SIPFLILMVALIPFTRLIVGTTYGVWAAVVPLTIAATPFFARIAEVSLREVDHGLIEAAQ 121 Query: 133 AMGASTRQIIWNALLPEARPGIIAAITVTAITLVSYTAMAGVVGAGGLGDLAIRFGYQRF 192 AMG I+W+ LLPEA PGI+ T+T +T+++ +AMAG +GAGGLGD+A R+GYQRF Sbjct: 122 AMGCRRWHIVWHVLLPEALPGIVGGFTITLVTMINSSAMAGAIGAGGLGDIAYRYGYQRF 181 Query: 193 QTDVMVVTVVMLLILVQILQTVGDKL 218 + +M+ +V+L+ILV ++Q GD+L Sbjct: 182 DSQIMLTVIVLLVILVAVIQLGGDRL 207 Lambda K H 0.329 0.143 0.419 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 139 Number of extensions: 5 Number of successful extensions: 1 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 225 Length of database: 214 Length adjustment: 22 Effective length of query: 203 Effective length of database: 192 Effective search space: 38976 Effective search space used: 38976 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.8 bits) S2: 45 (21.9 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory