GapMind for catabolism of small carbon sources

 

Alignments for a candidate for PA5504 in Pseudomonas fluorescens FW300-N2E3

Align D-methionine ABC transporter membrane protein, component of L-Histidine uptake porter, MetIQN (characterized)
to candidate AO353_22195 AO353_22195 metal ABC transporter permease

Query= TCDB::Q9HT69
         (225 letters)



>FitnessBrowser__pseudo3_N2E3:AO353_22195
          Length = 223

 Score =  213 bits (541), Expect = 3e-60
 Identities = 111/213 (52%), Positives = 154/213 (72%), Gaps = 4/213 (1%)

Query: 11  NIDWYEIWL----ASVDTFWMLGGSLLFTVVLGLPLGVLLFLTGPRQMFEQKAVYTLLSL 66
           +IDW EI      A+ +T +M+  +  FT+++GLPLGVLLF++    ++    +   L  
Sbjct: 4   SIDWNEILQLVLNATGETLYMVLLAGFFTLLIGLPLGVLLFISRSGGLYPMPKLNKGLGG 63

Query: 67  VVNILRSLPFIILLIVMIPLTVLITGTSLGVAGAIPPLVVGATPFFARLVETALREVDKG 126
           +VN+ RSLPF+++LI +IPLT LI GT+LG   A+ P+ +GA PFFAR+VE AL EVDKG
Sbjct: 64  LVNLGRSLPFVVMLIALIPLTRLIVGTTLGSTAAVVPITIGAFPFFARIVENALDEVDKG 123

Query: 127 IIEATQAMGASTRQIIWNALLPEARPGIIAAITVTAITLVSYTAMAGVVGAGGLGDLAIR 186
            IEA  AMG   R +I+  LLPEA P ++A IT+T + L+ +++MAGV+G GGLGDLAIR
Sbjct: 124 RIEAILAMGGDIRHVIFKVLLPEALPALLAGITLTLVMLIGFSSMAGVIGGGGLGDLAIR 183

Query: 187 FGYQRFQTDVMVVTVVMLLILVQILQTVGDKLV 219
           +GYQRF   VMV TVV+L+ILVQ +Q++GD+LV
Sbjct: 184 YGYQRFNNQVMVATVVVLVILVQGVQSLGDRLV 216


Lambda     K      H
   0.329    0.143    0.419 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 1
Number of Hits to DB: 123
Number of extensions: 8
Number of successful extensions: 1
Number of sequences better than 1.0e-02: 1
Number of HSP's gapped: 1
Number of HSP's successfully gapped: 1
Length of query: 225
Length of database: 223
Length adjustment: 22
Effective length of query: 203
Effective length of database: 201
Effective search space:    40803
Effective search space used:    40803
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 15 ( 7.1 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 40 (21.8 bits)
S2: 46 (22.3 bits)

This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.

Links

Downloads

Related tools

About GapMind

Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.

A candidate for a step is "high confidence" if either:

where "other" refers to the best ublast hit to a sequence that is not annotated as performing this step (and is not "ignored").

Otherwise, a candidate is "medium confidence" if either:

Other blast hits with at least 50% coverage are "low confidence."

Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:

GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).

For more information, see the paper from 2019 on GapMind for amino acid biosynthesis, the paper from 2022 on GapMind for carbon sources, or view the source code.

If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know

by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory