Align Transmembrane component of a broad range amino acid ABC transporter (characterized, see rationale)
to candidate AO353_13350 AO353_13350 branched-chain amino acid ABC transporter permease
Query= uniprot:Q1MCU1 (463 letters) >FitnessBrowser__pseudo3_N2E3:AO353_13350 Length = 432 Score = 314 bits (805), Expect = 3e-90 Identities = 192/427 (44%), Positives = 255/427 (59%), Gaps = 29/427 (6%) Query: 16 VRKGLTEALFAAVLSFGMFVLYVGLKTDQNISNELIIVQRWGLLAIFVAVAAIGRFAMVV 75 V+K L + + A +++ +F VG+ + N W V IGR A+ + Sbjct: 11 VKKSLIDTVLAGLIALIVFGPIVGVVLEGYSYNLQPTRVAW-----MVGAVMIGRLALSL 65 Query: 76 FIRPNIDRRKLSKAREGELDISTEKSFFHRHFLKIALIALLLYPMVVVAIKGPQGSLTYV 135 F++ K K ++ + + F + + ++ ++V+AI P + Y+ Sbjct: 66 FMQT----AKGEKVQQRFEIVGSGVHVLAPDFK--SRLRFIIPALIVIAIVFPVFADKYL 119 Query: 136 DNFGIQILIYVMLAWGLNIVVGLAGLLDLGYVAFYAVGAYSYALLSSYFGLSFWVLLPLS 195 I LIYV+L GLNIVVGLAGLLDLGYVAFYA+GAY AL Y GL FW +LPLS Sbjct: 120 LTVVILGLIYVLLGLGLNIVVGLAGLLDLGYVAFYAIGAYGLALGYHYLGLGFWTVLPLS 179 Query: 196 GIFAALWGVILGFPVLRLRGDYLAIVTLAFGEIIRLVLINWTDVTKGTFGISSIPKATLF 255 + AAL G ILGFPVLR+ GDYLAIVTL FGEIIRL+L NW T G G+ +P + F Sbjct: 180 ALMAALAGCILGFPVLRMHGDYLAIVTLGFGEIIRLILTNWLSFTGGPNGM-PVPSPSFF 238 Query: 256 GIPFDATA--GG--FAKLFHLPISSAYYKIFLFYLILALCMLTAYVTIRLRRMPIGRAWE 311 GI F A GG F + F + +F++ ++ + ML Y+ RL RMP+GRAWE Sbjct: 239 GIEFTRVAKDGGIPFHEFFGTEYNPNIKFMFIYAVLFLVVMLVLYIKHRLTRMPVGRAWE 298 Query: 312 ALREDEIACRSLGINTVTTKLTAFATGAMFAGFAGSFFAARQGFVSPESFVFLESAVILA 371 ALREDEIACR++G+N V KL+AF GA AG AG FFA+ QGFV+P SF F ESA+ILA Sbjct: 299 ALREDEIACRAMGLNHVLVKLSAFTLGASTAGLAGVFFASYQGFVNPTSFTFFESALILA 358 Query: 372 IVVLGGMGSLTGIAIAAIVMVGGTELLREMSFLKLIFGPDFTPELYRMLIFGLAMVVVML 431 IVVLGGMGS G+ IAA V+ ELLR + YR+L+FG+ MV++M+ Sbjct: 359 IVVLGGMGSTVGVVIAAFVLTVAPELLRGFA-------------EYRVLLFGILMVLMMI 405 Query: 432 FKPRGFV 438 +KPRG + Sbjct: 406 WKPRGLI 412 Lambda K H 0.330 0.145 0.432 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 622 Number of extensions: 38 Number of successful extensions: 5 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 463 Length of database: 432 Length adjustment: 33 Effective length of query: 430 Effective length of database: 399 Effective search space: 171570 Effective search space used: 171570 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.8 bits) S2: 51 (24.3 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory