Align ATP-binding component of a broad range amino acid ABC transporter (characterized, see rationale)
to candidate AO353_13530 AO353_13530 ABC transporter ATP-binding protein
Query= uniprot:Q1MCU2 (292 letters) >FitnessBrowser__pseudo3_N2E3:AO353_13530 Length = 289 Score = 136 bits (342), Expect = 6e-37 Identities = 93/260 (35%), Positives = 140/260 (53%), Gaps = 19/260 (7%) Query: 13 TLLKVEHLSMKFGGLMAINDFSFEAKRGDITALIGPNGAGKTTVFNCITGFYKPTMGMIT 72 T+L +E +S+ F G A+N + G++ +IGPNGAGKTT+ + ITG +P+ G Sbjct: 47 TILTLEDISVSFDGFKALNALNLYIGVGELRCIIGPNGAGKTTLMDVITGKTRPSHGNAW 106 Query: 73 FNQKSGKQYLLERLPDFRITKEARVARTFQNIRLFSGLTVLENLLVAQH-NKLMKASGYT 131 F G+ L R+ + +I +A + R FQ +F L+V ENL +AQ +K + AS Sbjct: 107 F----GETLDLTRMSEVQIA-QAGIGRKFQKPTVFEALSVFENLELAQKTDKSVWASLRA 161 Query: 132 ILGLIGVGPYKREAAEAIELARFWLEKADLIDRADDPAGDLPYGAQRRLEIARAMCTGPE 191 L G K E +E R L + PAG L +G ++ LEI + P+ Sbjct: 162 RLS----GEQKDRICEVLETIR-------LTTSVNRPAGLLSHGQKQFLEIGMLLMQDPQ 210 Query: 192 LLCLDEPAAGLNPRESATLNALLKSIRAETGTSILLIEHDMSVVMEISDHVVVLEYGQKI 251 LL LDEP AG+ E+ L KS+ + S++++EHDM V I+DHV VL G + Sbjct: 211 LLLLDEPVAGMTDAETEFTAELFKSLAGK--HSLMVVEHDMGFVGSIADHVTVLHQGSVL 268 Query: 252 SDGTPDHVKNDPRVIAAYLG 271 ++G+ V+++ RVI YLG Sbjct: 269 AEGSLAQVQDNERVIEVYLG 288 Lambda K H 0.318 0.136 0.386 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 184 Number of extensions: 8 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 292 Length of database: 289 Length adjustment: 26 Effective length of query: 266 Effective length of database: 263 Effective search space: 69958 Effective search space used: 69958 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory