Align ATP-binding component of a broad range amino acid ABC transporter (characterized, see rationale)
to candidate AO353_25645 AO353_25645 amino acid transporter
Query= uniprot:Q1MCU2 (292 letters) >FitnessBrowser__pseudo3_N2E3:AO353_25645 Length = 253 Score = 101 bits (251), Expect = 2e-26 Identities = 75/249 (30%), Positives = 127/249 (51%), Gaps = 30/249 (12%) Query: 15 LKVEHLSMKFGGLMAINDFSFEAKRGDITALIGPNGAGKTTVFNCITGFYKPTMGMITFN 74 L VE+L +FG + S A+ GD+ ++IG +G+GK+T+ CI + G I Sbjct: 4 LTVENLYKRFGDNEVLKGVSLNARAGDVVSMIGASGSGKSTMLRCINFLERADEGAI--- 60 Query: 75 QKSGKQYLLERLP-DFRITKEA-------RVARTFQNIRLFSGLTVLENLLVAQHNKLMK 126 + G++ + + P R+ A R+A FQ+ L+S LTVLEN+++A Sbjct: 61 ELDGERIVTRQAPGGMRVANPAQLQRLRTRLAMVFQHFNLWSHLTVLENIMLAP------ 114 Query: 127 ASGYTILGLIGVGPYKREAAEAIELARFWLEKADLIDR-ADDPAGDLPYGAQRRLEIARA 185 +LG+ R+ AE AR +L+K L R A+ L G Q+R+ IARA Sbjct: 115 ---CKVLGV------SRKDAEV--SARAYLDKVGLPQRVAEQYPAFLSGGQQQRVAIARA 163 Query: 186 MCTGPELLCLDEPAAGLNPRESATLNALLKSIRAETGTSILLIEHDMSVVMEISDHVVVL 245 + P++L DEP + L+P + +++++ AE G ++L++ H+M ++S V+ L Sbjct: 164 LAVEPQILLFDEPTSALDPELVGEVLKVIQAL-AEEGRTMLMVTHEMGFARQVSSQVLFL 222 Query: 246 EYGQKISDG 254 G+ G Sbjct: 223 HQGRVEEQG 231 Lambda K H 0.318 0.136 0.386 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 156 Number of extensions: 9 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 292 Length of database: 253 Length adjustment: 25 Effective length of query: 267 Effective length of database: 228 Effective search space: 60876 Effective search space used: 60876 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory