Align Histidine transport ATP-binding protein HisP (characterized)
to candidate AO353_27990 AO353_27990 amino acid transporter
Query= SwissProt::P02915 (258 letters) >FitnessBrowser__pseudo3_N2E3:AO353_27990 Length = 254 Score = 360 bits (925), Expect = e-104 Identities = 179/254 (70%), Positives = 213/254 (83%), Gaps = 1/254 (0%) Query: 5 NKLHVIDLHKRYGGHEVLKGVSLQARAGDVISIIGSSGSGKSTFLRCINFLEKPSEGAII 64 N L + DLHKRYG HEVLKGVSL+A+AGDVISIIGSSGSGKSTFLRCIN LE+P+ G I+ Sbjct: 2 NTLEIQDLHKRYGTHEVLKGVSLEAKAGDVISIIGSSGSGKSTFLRCINLLEQPNSGNIL 61 Query: 65 VNGQNINLVRDKDGQLKVADKNQLRLLRTRLTMVFQHFNLWSHMTVLENVMEAPIQVLGL 124 +NG+ + LV +K G LK A+ QL+ +R+RL MVFQHFNLWSHM+ LENVMEAP+ VLGL Sbjct: 62 LNGEQLKLVANKTGGLKAAEPKQLQRMRSRLAMVFQHFNLWSHMSALENVMEAPVHVLGL 121 Query: 125 SKHDARERALKYLAKVGIDERAQGKYPVHLSGGQQQRVSIARALAMEPDVLLFDEPTSAL 184 K ARE+A YL KVG+ R G YP H+SGG+QQRV+IARALAMEP+V+LFDEPTSAL Sbjct: 122 DKKLAREKAEHYLNKVGVAHR-MGAYPAHMSGGEQQRVAIARALAMEPEVMLFDEPTSAL 180 Query: 185 DPELVGEVLRIMQQLAEEGKTMVVVTHEMGFARHVSSHVIFLHQGKIEEEGDPEQVFGNP 244 DPELVGEVL++MQ LA EG+TMVVVTHEMGFAR VS+ ++FLH+G++EE G+P +V NP Sbjct: 181 DPELVGEVLKVMQDLALEGRTMVVVTHEMGFAREVSNQLVFLHKGQVEERGNPREVLVNP 240 Query: 245 QSPRLQQFLKGSLK 258 QS RLQQFL GSLK Sbjct: 241 QSERLQQFLAGSLK 254 Lambda K H 0.319 0.136 0.383 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 251 Number of extensions: 8 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 258 Length of database: 254 Length adjustment: 24 Effective length of query: 234 Effective length of database: 230 Effective search space: 53820 Effective search space used: 53820 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory