Align High-affinity branched-chain amino acid ABC transporter permease LivM (characterized, see rationale)
to candidate AO353_13535 AO353_13535 urea ABC transporter permease subunit UrtC
Query= uniprot:A0A159ZYE0 (418 letters) >FitnessBrowser__pseudo3_N2E3:AO353_13535 Length = 359 Score = 105 bits (261), Expect = 3e-27 Identities = 94/332 (28%), Positives = 149/332 (44%), Gaps = 56/332 (16%) Query: 107 FFGSRGAVDIATLILIYVMLGLGLNIVVGLAGLLDLGYVGFYAVGAYSYALLS------- 159 F S + +A IL Y ++ L L++V G AGLL LG+ F+A+G Y+ + Sbjct: 44 FHVSAYTLTLAGKILCYAIVALALDLVWGYAGLLSLGHGLFFALGGYAMGMYLMRQASGD 103 Query: 160 ----------------HYFGLSFWI---CLPIA--GMMAATFGFLLGFPVLRLRGDYLAI 198 ++ G S +I CL + G++A FGF R++G Y +I Sbjct: 104 GLPAFMTFLSWTELPWYWTGTSSFIWAMCLVVLAPGLLALVFGFFAFRS--RIKGVYFSI 161 Query: 199 VT--LGFGEIIRLFLRNLTDITGGPNGISNIEKPTFFGLTFERKAAEGLQTFHEYFGLEY 256 +T L F ++ LF RN T GG NG +N FG+T A Sbjct: 162 MTQALTFAGML-LFFRNETGF-GGNNGFTNFCTILGFGITEPGTRA-------------- 205 Query: 257 NSINKVIFLYLVALLLALAALFVINRLLRMPIGRAWEALREDEIACRALGLNPTVIKLSA 316 L++ +LL +A+LF+ RL + GR ALR+ E G +P KL Sbjct: 206 -------VLFVATVLLLVASLFIGWRLAQSKFGRVLTALRDAENRLMFCGYDPRGFKLFV 258 Query: 317 FTLGAAFAGFAGSFFAARQGLVTPESFTFIESAIILAIVVLGGMGSQLGVIL-AAIVMIL 375 + L A G AG+ + + G++ P + S V LGG G+ +G +L A +V + Sbjct: 259 WVLSAVLCGLAGALYVPQVGIINPSEMSPTNSIEAAVWVALGGRGTLIGPLLGAGVVNGM 318 Query: 376 LPEMMREFSEYRMLMFGALMVLMMIWRPQGLL 407 F EY + GAL +++ ++ P+G++ Sbjct: 319 KSWFTVAFPEYWLFFLGALFIVVTLYLPKGVI 350 Lambda K H 0.331 0.145 0.439 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 453 Number of extensions: 23 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 418 Length of database: 359 Length adjustment: 30 Effective length of query: 388 Effective length of database: 329 Effective search space: 127652 Effective search space used: 127652 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.2 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.9 bits) S2: 50 (23.9 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory