Align UDP-glucose 4-epimerase; EC 5.1.3.2; Galactowaldenase; UDP-galactose 4-epimerase (uncharacterized)
to candidate AO353_21135 AO353_21135 UDP-galactose-4-epimerase
Query= curated2:Q9KDV3 (334 letters) >FitnessBrowser__pseudo3_N2E3:AO353_21135 Length = 325 Score = 347 bits (890), Expect = e-100 Identities = 167/323 (51%), Positives = 214/323 (66%) Query: 1 MAILVTGGAGYIGSHTVLFLLEQGEQVIVLDNLQKGHAGALSDVTFYHGDIRDDQLLDTI 60 M LV GGAGYIGSH V LL G + +V DN GH GAL DI D Q LD + Sbjct: 1 MKFLVVGGAGYIGSHMVKQLLRAGHEPVVADNFSTGHRGALMGGRLVELDIADAQALDVL 60 Query: 61 FTTHSIDTVIHFAANSLVGESVKQPIEYYENNVIGTHTLLKKMLEHDVKKIVFSSTAATY 120 F D V HFA+ + VGESV +P +YY+NN+ GT TLL+ ++ VK +FSS+AA Y Sbjct: 61 FAGQHFDAVFHFASFTQVGESVTEPAKYYQNNLAGTLTLLQAVVRAGVKNFIFSSSAAIY 120 Query: 121 GEPVQIPIQESDPTIPTNPYGETKLAIEKMFHWCQEAYGLQYVCLRYFNAAGADPNGRIG 180 G+PV +PI E P NPYG +K +E+M AYGL+ VCLRYFNAAGADP G++G Sbjct: 121 GDPVYVPIDEEHPKAAINPYGRSKWMVEQMLEDFDRAYGLKSVCLRYFNAAGADPEGQLG 180 Query: 181 EDHSPESHLIPIVLQVALGQRERVAIFGDDYQTEDGSCIRDYIHVMDLANAHYLACEHLR 240 E PE+HL+P++LQ A G+R + ++G DY T DG+CIRDYIHV+DL AH LA +L Sbjct: 181 ERREPETHLLPLILQAASGRRTTITVYGRDYDTPDGTCIRDYIHVVDLVAAHALAVNYLL 240 Query: 241 KDGQSGSFNLGNGKGFSVKEVIEVCRQVTGHPIPAEIAPRRSGDPASLIASSEKAQTILG 300 G S + NLGNG+GFSV++VI+ R VTG I APRR GDP L+A A T+LG Sbjct: 241 AGGASTALNLGNGQGFSVQQVIDTARAVTGQGISVSEAPRRVGDPPRLVADPRMANTLLG 300 Query: 301 WEPKYPSLETMVEHAWNWHKEHP 323 W+P+Y SLE +V HAW+W +++P Sbjct: 301 WQPQYASLEQIVAHAWSWEQKYP 323 Lambda K H 0.317 0.135 0.411 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 372 Number of extensions: 16 Number of successful extensions: 1 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 334 Length of database: 325 Length adjustment: 28 Effective length of query: 306 Effective length of database: 297 Effective search space: 90882 Effective search space used: 90882 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 49 (23.5 bits)
Align candidate AO353_21135 AO353_21135 (UDP-galactose-4-epimerase)
to HMM TIGR01179 (galE: UDP-glucose 4-epimerase GalE (EC 5.1.3.2))
# hmmsearch :: search profile(s) against a sequence database # HMMER 3.3.1 (Jul 2020); http://hmmer.org/ # Copyright (C) 2020 Howard Hughes Medical Institute. # Freely distributed under the BSD open source license. # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query HMM file: ../tmp/path.carbon/TIGR01179.hmm # target sequence database: /tmp/gapView.7658.genome.faa # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: TIGR01179 [M=332] Accession: TIGR01179 Description: galE: UDP-glucose 4-epimerase GalE Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 1.7e-134 433.8 0.0 2.1e-134 433.5 0.0 1.0 1 lcl|FitnessBrowser__pseudo3_N2E3:AO353_21135 AO353_21135 UDP-galactose-4-epim Domain annotation for each sequence (and alignments): >> lcl|FitnessBrowser__pseudo3_N2E3:AO353_21135 AO353_21135 UDP-galactose-4-epimerase # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 433.5 0.0 2.1e-134 2.1e-134 2 328 .. 3 322 .. 2 324 .. 0.99 Alignments for each domain: == domain 1 score: 433.5 bits; conditional E-value: 2.1e-134 TIGR01179 2 iLvtGgaGyiGshvvrqllekgkevvvlDnlskgskealkalekitevklvegdladkekleavl 66 Lv+GgaGyiGsh+v+qll++g+e vv Dn s+g++ al ++ lve d+ad+++l+ ++ lcl|FitnessBrowser__pseudo3_N2E3:AO353_21135 3 FLVVGGAGYIGSHMVKQLLRAGHEPVVADNFSTGHRGALMGGR------LVELDIADAQALDVLF 61 79****************************************9......**************** PP TIGR01179 67 eeekidaviHfaaliavgEsvkePlkYYennvvntleLleamqkagvkkliFsssaavYgesekv 131 + +++dav Hfa++++vgEsv+eP+kYY+nn+ +tl+Ll+a+++agvk++iFsssaa+Yg++ v lcl|FitnessBrowser__pseudo3_N2E3:AO353_21135 62 AGQHFDAVFHFASFTQVGESVTEPAKYYQNNLAGTLTLLQAVVRAGVKNFIFSSSAAIYGDPVYV 126 ***************************************************************** PP TIGR01179 132 pisEesplnpinpYGrsklmvErilkdlkkadkelkvviLRYFnvaGAdeegeiGeasknathli 196 pi Ee+p ++inpYGrsk mvE++l+d+ +a ++lk v LRYFn+aGAd+eg++Ge+ +++thl+ lcl|FitnessBrowser__pseudo3_N2E3:AO353_21135 127 PIDEEHPKAAINPYGRSKWMVEQMLEDFDRA-YGLKSVCLRYFNAAGADPEGQLGERREPETHLL 190 *******************************.********************************* PP TIGR01179 197 klvaevavgkrekleifGtdyptkDGtcvRDyiHveDlaeaHlaalealeeggesevynlGagqg 261 +l++++a+g+r +++++G dy+t+DGtc+RDyiHv Dl +aH a+++l +gg s+++nlG+gqg lcl|FitnessBrowser__pseudo3_N2E3:AO353_21135 191 PLILQAASGRRTTITVYGRDYDTPDGTCIRDYIHVVDLVAAHALAVNYLLAGGASTALNLGNGQG 255 ***************************************************************** PP TIGR01179 262 fsvkevieavkkvsgkdikveladrRaGDpaslvadaskikrelgwkpkyddLeeiiksawdWek 326 fsv++vi+++++v+g+ i+v++a+rR GDp++lvad+ +++ lgw+p+y Le+i++ aw+We+ lcl|FitnessBrowser__pseudo3_N2E3:AO353_21135 256 FSVQQVIDTARAVTGQGISVSEAPRRVGDPPRLVADPRMANTLLGWQPQYASLEQIVAHAWSWEQ 320 ****************************************************************9 PP TIGR01179 327 kl 328 k lcl|FitnessBrowser__pseudo3_N2E3:AO353_21135 321 KY 322 86 PP Internal pipeline statistics summary: ------------------------------------- Query model(s): 1 (332 nodes) Target sequences: 1 (325 residues searched) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.01s 00:00:00.01 Elapsed: 00:00:00.01 # Mc/sec: 10.01 // [ok]
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory