Align L-arabinose 1-dehydrogenase / D-galactose 1-dehydrogenase (EC 1.1.1.46; EC 1.1.1.48) (characterized)
to candidate AO353_01660 AO353_01660 short-chain dehydrogenase
Query= reanno::pseudo6_N2E2:Pf6N2E2_5967 (272 letters) >FitnessBrowser__pseudo3_N2E3:AO353_01660 Length = 253 Score = 141 bits (356), Expect = 1e-38 Identities = 83/245 (33%), Positives = 132/245 (53%), Gaps = 4/245 (1%) Query: 22 KVVLLTGAAQGIGEAIVAAFASQQARLVISDIQAEKVETVAAHWRERGADVHALKADVSN 81 +V L+TGAA GIG A AFA++ ++V++D+ E A R G + ++ +V+ Sbjct: 8 QVALVTGAAAGIGRATAQAFAAEGLKVVVADLDVAGGEGTAELIRAAGGEAVFVQCNVTQ 67 Query: 82 QQDLHAMARHAVERHGRIDVLVNCAGVNVFRDPL-EMTEEDWRRCFAIDLDGAWYGCKAV 140 + D+ + AV +GR+D N AG+ + + L E T +++ +++ G W K Sbjct: 68 ESDVQNLMAKAVSTYGRLDYAFNNAGIEIEKGKLAEGTLDEFDAIMGVNVKGVWLCMKYQ 127 Query: 141 LPQMIEQGVGSIINIASTHSSHIIPGCFPYPVAKHGLLGLTRALGIEYAPKGVRVNAIAP 200 LP M+ QG G+I+N AS P Y +KH ++GLT++ IEYA K +RVNA+ P Sbjct: 128 LPLMLAQGGGAIVNTASVAGLGAAPKMSIYAASKHAVIGLTKSAAIEYAKKKIRVNAVCP 187 Query: 201 GYIETQLNVDYWNGFADPYAERQRALDLHPPRRIGQPIEVAMTAVFLASDEAPFINASCI 260 I+T + + ADP + A +HP RIG+ E+A ++L SD A F + Sbjct: 188 AVIDTDMFRRAYE--ADP-KKADFAAAMHPVGRIGKVEEIASAVLYLCSDGAAFTTGHSL 244 Query: 261 TIDGG 265 +DGG Sbjct: 245 AVDGG 249 Lambda K H 0.321 0.137 0.419 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 144 Number of extensions: 7 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 272 Length of database: 253 Length adjustment: 25 Effective length of query: 247 Effective length of database: 228 Effective search space: 56316 Effective search space used: 56316 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory