Align Methylglutaconyl-CoA hydratase (EC 4.2.1.18) (characterized)
to candidate AO353_19310 AO353_19310 enoyl-CoA hydratase
Query= reanno::pseudo6_N2E2:Pf6N2E2_2193 (272 letters) >FitnessBrowser__pseudo3_N2E3:AO353_19310 Length = 265 Score = 141 bits (356), Expect = 1e-38 Identities = 93/256 (36%), Positives = 133/256 (51%), Gaps = 5/256 (1%) Query: 7 LELHSDPRGVATLWLSRESKNNAFNAEMIRELILALDHVSSDPNLRFLLIRGRGKHFSAG 66 LELH+ GV L L+R NA + +M+ EL L V D ++R +++ G G HFSAG Sbjct: 12 LELHN---GVLHLTLNRPDCRNAMSLQMVAELRAVLAAVRDDRDIRAIVLGGAGGHFSAG 68 Query: 67 ADLAWMQQSAELDYHTNLDDARELAELMYNLAKLKIPTLAVVQGAAFGGALGLISACDMA 126 DL M + + R L+ + V+QGA GG GL+ D+A Sbjct: 69 GDLKDMANARAQGQQAYRELNRAFGALLEEAQHAPQVLITVLQGAVLGGGFGLVCVSDIA 128 Query: 127 IGADEAQFCLSEVRIGLAPAVISPFVVQAIGERAARRYALTAERFDGQRAKEIGLLS-ES 185 + AQF L E +GL PA I+PFVVQ IG ARR ALTA RFDG A+ +GL+ Sbjct: 129 LTDHNAQFGLPETSLGLLPAQIAPFVVQRIGLTQARRLALTAARFDGHEARRLGLVHFVE 188 Query: 186 YPAEVLDQQVEQWIDNLLLNSPAAMRASKELLREVGNGALTPALRRYTENAIARIRVSPE 245 + A+ L ++++ + ++L +P A A+K LL ++ P L + + + E Sbjct: 189 HDAQALAERLDAVLAHVLCCAPGANAATKVLLLASTEQSMGPLLDQ-AADWFSEAVTGAE 247 Query: 246 GQEGLRAFLQKRAPNW 261 G EG AF+QKR P W Sbjct: 248 GVEGTMAFVQKRKPGW 263 Lambda K H 0.318 0.133 0.382 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 151 Number of extensions: 7 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 272 Length of database: 265 Length adjustment: 25 Effective length of query: 247 Effective length of database: 240 Effective search space: 59280 Effective search space used: 59280 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory