Align Methylglutaconyl-CoA hydratase, mitochondrial; AU-specific RNA-binding enoyl-CoA hydratase; AU-binding enoyl-CoA hydratase; muAUH; Itaconyl-CoA hydratase; EC 4.2.1.18; EC 4.2.1.56 (characterized)
to candidate AO353_24830 AO353_24830 enoyl-CoA hydratase
Query= SwissProt::Q9JLZ3 (314 letters) >FitnessBrowser__pseudo3_N2E3:AO353_24830 Length = 263 Score = 120 bits (301), Expect = 3e-32 Identities = 87/262 (33%), Positives = 126/262 (48%), Gaps = 10/262 (3%) Query: 57 LEEENRGIVVLGINRAYGKNALSKNLLKMLSKAVDALKSDKKVRTIIIRSEVPGIFCAGA 116 L + G+ + +NR +NAL LK L +D +D VR +++ FCAGA Sbjct: 8 LSQVEAGVAWITLNRTAQRNALDIPTLKNLHALLDDFNADPAVRVVVLTGSGRS-FCAGA 66 Query: 117 DLKERAKMHSS---EVGPFVSKIRSVINDIANLPVPTIAAIDGLALGGGLELALACDIRV 173 DL E A+ + E + ++++ + +L PTIAAI+G A+G G++L L CD+R+ Sbjct: 67 DLAEWAEAEARGALESYGWTETAHALMSRLYSLDKPTIAAINGTAVGAGMDLTLCCDLRI 126 Query: 174 AASSAKMGLVETKLAIIPGGGGTQRLPRAIGMSLAKELIFSARVLDGQEAKAVGLISHVL 233 A SA+ T +A P G + LPR IG AK L+F + A A GL+S V Sbjct: 127 AGQSARFKAGYTSMAYSPDAGASWHLPRLIGTEQAKRLLFLDELWGADRALAAGLVSEVC 186 Query: 234 EQNQEGDAAYRKALDLAREFLPQGPV-AMRVAKLAINQGMEVDLVTGLAIEEACYAQTIS 292 Q AA A LA GP A K + +G + L L E A Sbjct: 187 ADEQLLGAASELATRLA-----NGPTFAFAQTKKLMREGAQRSLPEQLHAELAAGLLCGR 241 Query: 293 TKDRLEGLLAFKEKRPPRYKGE 314 ++D E L A EKRPP++ G+ Sbjct: 242 SEDGAEALRAAMEKRPPQFVGK 263 Lambda K H 0.318 0.135 0.377 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 155 Number of extensions: 12 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 314 Length of database: 263 Length adjustment: 26 Effective length of query: 288 Effective length of database: 237 Effective search space: 68256 Effective search space used: 68256 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory