Align 5-aminopentanamidase (EC 3.5.1.30) (characterized)
to candidate AO353_15200 AO353_15200 hydratase
Query= reanno::pseudo5_N2C3_1:AO356_14225 (264 letters) >FitnessBrowser__pseudo3_N2E3:AO353_15200 Length = 295 Score = 92.0 bits (227), Expect = 1e-23 Identities = 92/284 (32%), Positives = 139/284 (48%), Gaps = 30/284 (10%) Query: 1 MRVALYQCPPLP--LDPAGNLHRLHQVALEA--RGADVLVLPEMFMTGYNIG--VDAVNV 54 +RVA+ Q P + GNLH ++AL+A GA+++V+PE+ TGY DA + Sbjct: 8 VRVAVVQFDPQVGIENREGNLHHSLELALQAVNGGANLIVMPELTNTGYFFSNRQDAFDH 67 Query: 55 LAEVYNGEWAQQIGRIAKAANLAIVYGYPERGEDG-QIYNAVQLIDAQGERLANYRKSHL 113 V G Q A + +V G ER DG +++N L+ G + YRK+HL Sbjct: 68 SEAVPGGPSTQSWVDFACKHKVYLVAGLTER--DGMRLFNTGILVGPDGF-IGKYRKAHL 124 Query: 114 FGDLDHAMFSAGDSALPIVELNGWKLGLLICYDLEFPENARRLALAGAELI--------L 165 + +L+ F+ GD P+ + ++GLLIC+D+ FPE R L+ GA++I Sbjct: 125 W-NLEKLWFTPGDLGFPVFDTPIGRIGLLICWDIWFPEVPRILSQQGADIICSLNNWVWT 183 Query: 166 VPTANMQPYEFIADVTVRARAIENQCFVAYANYCGHEAELQYCGQSSIAAPNG-SRPALA 224 P + +A A N F+A A+ G E +Y G S IA NG A+A Sbjct: 184 PPPLFDDAGKCMASYLTMTAAHVNNVFIAAASRIGEERGARYLGCSLIAGTNGWPIGAVA 243 Query: 225 GLD-EALIVGELDRQLLDDSRAA-----YNYLH-DRRPELYDDL 261 D + ++ ++D L SR+A N LH DRR +LYD + Sbjct: 244 SADKQEILFADID---LTSSRSAPIWNNLNDLHRDRRADLYDQM 284 Lambda K H 0.321 0.139 0.419 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 208 Number of extensions: 14 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 264 Length of database: 295 Length adjustment: 26 Effective length of query: 238 Effective length of database: 269 Effective search space: 64022 Effective search space used: 64022 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory