Align 4-aminobutyrate aminotransferase PuuE; GABA aminotransferase; GABA-AT; Gamma-amino-N-butyrate transaminase; GABA transaminase; Glutamate:succinic semialdehyde transaminase; EC 2.6.1.19 (characterized)
to candidate AO353_15640 AO353_15640 acetylornithine aminotransferase
Query= SwissProt::P50457 (421 letters) >FitnessBrowser__pseudo3_N2E3:AO353_15640 Length = 391 Score = 196 bits (499), Expect = 8e-55 Identities = 128/385 (33%), Positives = 193/385 (50%), Gaps = 32/385 (8%) Query: 34 LKDVEGNEYIDFAAGIAVLNTGHRHPDLVAAVEQQLQQFTHTAYQIVPYESYVTLAEKIN 93 L D G EY+D AG+AV N GH HP +V+A+ +Q HT+ + + LA K+ Sbjct: 25 LWDQAGREYLDAVAGVAVTNVGHSHPKVVSAISEQAGLLLHTS-NLYSIDWQQRLAHKLT 83 Query: 94 ALAPVSGQAKTAFFTTGAEAVENAVKIARA---HTG--RPGVIAFSGGFHGRTYMTMALT 148 L SG + F +GAEA E A+K+AR H G +P V+ FHGRT T++ + Sbjct: 84 QL---SGLDRVFFNNSGAEANETALKLARLYGWHKGVEQPLVVVMENAFHGRTLGTLSAS 140 Query: 149 GKVAPYKIGFGPFPGSVYHVPYPSDLHGISTQDSLDAIERLFKSDIEAKQVAAIIFEPVQ 208 A ++GF PG VP+ L A+++ ++ +++ A++ EP+Q Sbjct: 141 DGPA-VRLGFQELPGDFIKVPF----------GDLAALDKAHQT--HGQRIVAVLMEPIQ 187 Query: 209 GEGGFNVAPKELVAAIRRLCDEHGIVMIADEVQSGFARTGKLFAMDHYADKPDLMTMAKS 268 GE G +A + A+R LC+ +++ DE+Q+G RTG+ FA H PD+MT+AK Sbjct: 188 GESGVQLALPGYLKALRELCNRRNWLLMLDEIQTGIGRTGQWFAFQHEGIVPDVMTLAKG 247 Query: 269 LAGGMPLSGVVGNANIMDAPAPGGLGGTYAGNPLAVAAAHAVLNIIDKESLCERANQLGQ 328 L G+P+ + + PG G T+ GNPLA VL II+++ L E A + G+ Sbjct: 248 LGNGVPIGACLARGKAAELFTPGSHGSTFGGNPLACRVGCTVLEIIEEQGLLENAKRQGE 307 Query: 329 RLKNTLIDAKESVPAIAAVRGLGSMIAVEFNDPQTGEPSAAIAQKIQQRALAQGLLLLTC 388 RL L + P + A+RG G MI +E P I A GLL+ Sbjct: 308 RLLARLHAELDGSPQVLAIRGQGLMIGIELARP--------IRDLTLIAARDHGLLINV- 358 Query: 389 GAYGNVIRFLYPLTIPDAQFDAAMK 413 G IR L PLTI + + + ++ Sbjct: 359 -TRGKTIRLLPPLTIDEREVEMIVR 382 Lambda K H 0.319 0.134 0.388 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 381 Number of extensions: 24 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 421 Length of database: 391 Length adjustment: 31 Effective length of query: 390 Effective length of database: 360 Effective search space: 140400 Effective search space used: 140400 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 50 (23.9 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory