Align Aspartate aminotransferase; AAT; AspAT; Putative 2-aminoadipate transaminase; Transaminase A; EC 2.6.1.1; EC 2.6.1.39 (characterized)
to candidate AO353_26890 AO353_26890 aspartate aminotransferase
Query= SwissProt::P58350 (410 letters) >FitnessBrowser__pseudo3_N2E3:AO353_26890 Length = 395 Score = 219 bits (559), Expect = 9e-62 Identities = 137/396 (34%), Positives = 214/396 (54%), Gaps = 18/396 (4%) Query: 17 RISSIGVSEILKIGARAAAMKREGKPVIILGAGEPDFDTPEHVKQAASDAIHRGETKYTA 76 RI+ G ++ +I RA ++ +G V++L G+PDFDTP+ + QAA D++ G+T Y+ Sbjct: 9 RIAGDG-ADAWQIHYRALELREQGVDVLLLSVGDPDFDTPKPIVQAAIDSLLAGDTHYSE 67 Query: 77 LDGTPELKKAIREKFQRENGLAYELDEITVATGAKQILFNAMMASLDPGDEVIIPTPYWT 136 + GT L+ +I + R +G + D + V GA+ +++ + LDPGDEV++ P + Sbjct: 68 VRGTRSLRTSIARRHTRRSGQVVDADHVLVLPGAQCAVYSVVQCLLDPGDEVLVAEPMYV 127 Query: 137 SYSDIVHICEGKPVLIACDASSGFRLTAEKLEAAITPRTRWVLLNSPSNPSGAAYSAADY 196 +Y + C K V IA +GFR+ + A ITPRTR +LLNSP+NPSGA+ S A + Sbjct: 128 TYEGVFGACGAKVVPIAVRPENGFRVDPTDIAARITPRTRAILLNSPNNPSGASLSLAIW 187 Query: 197 RPLLEVLLRHPHVWLLVDDMYEHIVYDGFRFVTPAQLEPGLKNRTLTVNGVSKAYAMTGW 256 + L + ++H +WL+ D++Y ++Y+G ++PA L PG+ RT TVN +SK++AMTGW Sbjct: 188 QALARLCVKH-DLWLISDEVYSELLYEG-EHISPASL-PGMAERTATVNSLSKSHAMTGW 244 Query: 257 RIGYAGGPRELIKAMAVVQ-SQATSCPSSISQAASVAALNGPQDFLKERTESFQRRRDLV 315 R+G+ GP+ L + + + P + AA VA + R E ++ RRDLV Sbjct: 245 RVGWVIGPKRLTEHLENLSLCMLFGIPDFVQNAARVALEADLPELALMRNE-YRARRDLV 303 Query: 316 VNGLNAIDGLDCRVPEGAFYTFSGCAGVLGKVTPSGKRIKTDTDFCAYLLEDAHVAVVPG 375 L G+ +P+G + V+ V +G + F LLE V+V+ G Sbjct: 304 CARLGDCPGISPVIPDGGMF-------VMVDVRQTGVGAQA---FAEKLLEGYAVSVLAG 353 Query: 376 SAFGLSP--FFRISYATSEAELKEALERIAAACDRL 409 AFG S RI + L EA RI L Sbjct: 354 EAFGPSAAGHIRIGLVLDQQRLAEACRRIVHCATEL 389 Lambda K H 0.318 0.134 0.393 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 427 Number of extensions: 17 Number of successful extensions: 5 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 410 Length of database: 395 Length adjustment: 31 Effective length of query: 379 Effective length of database: 364 Effective search space: 137956 Effective search space used: 137956 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 50 (23.9 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory