Align The lysine specific transporter, LysP of 488 aas and 12 TMSs (characterized)
to candidate AO353_16120 AO353_16120 D-alanine/D-serine/glycine permease
Query= TCDB::K7VV21 (488 letters) >FitnessBrowser__pseudo3_N2E3:AO353_16120 Length = 472 Score = 299 bits (765), Expect = 2e-85 Identities = 174/462 (37%), Positives = 267/462 (57%), Gaps = 24/462 (5%) Query: 13 VKRGLKSRHVSMIALGGTIGTGLFLTSGDVIHTAGPFGALTAYVLIGAMVYFLMTSLGEM 72 +KR L RH+ ++ALG IG GLFL S I AGP + +Y++ G + +M +LGEM Sbjct: 18 LKRELGERHIRLMALGACIGVGLFLGSAKAIEMAGP-AIMLSYIIGGLAILVIMRALGEM 76 Query: 73 ATYLPTSGSFSDYGTRYVDPAFGFALGWNYWLNWAITVAVDLTAVALCIKFWLPDVPSWI 132 A + P +GSFS Y Y+ P GF GWNYW W +T ++TAVA+ + W P+VP WI Sbjct: 77 AVHNPVAGSFSRYAQDYLGPLAGFLTGWNYWFLWLVTCVAEITAVAVYMGIWFPEVPRWI 136 Query: 133 FSLIALIIVFSINALSVKTFGETEYWLSAIKITVVVLFLIIGFLSIFGIMGGHIDVAKNL 192 ++L AL+ + SIN ++VK FGE E+W + IKI V ++ +++G + + G+ VA + Sbjct: 137 WALAALVSMGSINLIAVKAFGEFEFWFALIKI-VTIIAMVVGGVGVIAFGFGNDGVALGI 195 Query: 193 S-VGNHGFVGGLGSFTTGG--GILGVLLVAGFSFQGTELLGITAGEAENPEKSIPKAMNS 249 S + +H G F G G+L L + F++ G E++G+TAGEA+NP+K+IP A+ S Sbjct: 196 SNLWSH------GGFMPNGVQGVLMSLQMVMFAYLGVEMIGLTAGEAKNPQKTIPNAIGS 249 Query: 250 IFWRILVFYILSIFVMAAIIPFTDPHLVGGNSAAQSPFTIVFERVGFSIAASIMNAVVLT 309 +FWRIL+FY+ ++FV+ +I P+ + G SPF + FER+G AA I+N VV+T Sbjct: 250 VFWRILLFYVGALFVILSIYPWNEIGTQG------SPFVMTFERLGIKTAAGIINFVVIT 303 Query: 310 SVVSAANSGMYASTRMLYSLAKDGGAPTIFSKTSKNGIPFIALLATTAVALL-TFLTSIY 368 + +S+ N G++++ RMLYSLA++G AP F+KTS NG+P ALL + LL L + Sbjct: 304 AALSSCNGGIFSTGRMLYSLAQNGQAPAGFAKTS-NGVPRRALLLSIGALLLGVLLNYLV 362 Query: 369 GVSFFTFLVSASGLTGFIAWIGIAISHFRFRRAYVAQGKDVKKLPYHAKLFPFGPILALI 428 F ++ + + W+ I ++ +FR+ + L Y L+P LAL Sbjct: 363 PEKVFVWVTAIATFGAIWTWVMILLAQLKFRKG--LSPAERAALKYRMWLYPVSSYLALA 420 Query: 429 MTVLVTLGQDPMLLFGKTWVQGVVMYAAIPLFFILYLGYKFK 470 V+V M F T V V A + L +L+ +K + Sbjct: 421 FLVMVV---GLMAYFPDTRVALYVGPAFLVLLTVLFYVFKLQ 459 Lambda K H 0.326 0.141 0.425 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 587 Number of extensions: 27 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 488 Length of database: 472 Length adjustment: 34 Effective length of query: 454 Effective length of database: 438 Effective search space: 198852 Effective search space used: 198852 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.6 bits) S2: 51 (24.3 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory