Align ABC-type maltose transport, ATP binding protein (characterized, see rationale)
to candidate AO353_03380 AO353_03380 sugar ABC transporter ATP-binding protein
Query= uniprot:Q6MNM2 (347 letters) >FitnessBrowser__pseudo3_N2E3:AO353_03380 Length = 386 Score = 312 bits (799), Expect = 1e-89 Identities = 170/364 (46%), Positives = 236/364 (64%), Gaps = 24/364 (6%) Query: 1 MAKIQFSNIKKSFGSA--DVLKGIDLDIAPGEFLVLVGPSGCGKSTLLRTLAGLESADSG 58 MA ++ N+ K++GS D LK I+L I GEFL+LVGPSGCGKSTL+ +AGLE+ G Sbjct: 1 MATLELRNVNKTYGSGLPDTLKNIELKIDDGEFLILVGPSGCGKSTLMNCIAGLENISGG 60 Query: 59 TISIDGKKINDIEPQNRDIAMVFQSYALYPHMTVAENMGFGLKLKNLAAAEITKRVNEIS 118 I +D I+ + P++RDIAMVFQSYALYP M+V +N+ FGLK++ + AAEI + V ++ Sbjct: 61 AILVDDADISGMSPKDRDIAMVFQSYALYPTMSVRDNIAFGLKIRKMPAAEIDEEVARVA 120 Query: 119 ELLQIKHLLDRKPKELSGGQRQRVALGRALSRQTPVILFDEPLSNLDAHLRSQMRLEIKR 178 +LLQI+HLL RKP +LSGGQ+QRVA+GRAL+R+ + LFDEPLSNLDA LR +MR E+K Sbjct: 121 KLLQIEHLLSRKPGQLSGGQQQRVAMGRALARRPKIYLFDEPLSNLDAKLRVEMRTEMKL 180 Query: 179 LHHNSKSTMIYVTHDQMEATTLGDRIAVLKDGVIEQIGTPSEIYHRPKNTFIATFIGSPE 238 +H K+T +YVTHDQ+EA TLGD++AV+KDG+I+Q GTP +IY+ P N F+A+FIGSP Sbjct: 181 MHQRLKTTTVYVTHDQIEAMTLGDKVAVMKDGIIQQFGTPKQIYNDPANLFVASFIGSPP 240 Query: 239 MNFL-------EGAVLEKIPWPEAR-------------KADQILGIRPDAFALNQGPLGT 278 MNF+ +G +L + +AR + ILG+RP+ L G Sbjct: 241 MNFIPLRLQRKDGRLLALLDSGQARCELPLGMQDAGLEDREVILGMRPEQIVLANGEANG 300 Query: 279 QEVALGDFQIDISENLGGQQMLHGTLAGNNVRILVDSMDNFSMKQTLPLKIDLTKAHLFD 338 + Q+ +E G ++ L V + ++ +TL L+ D +K LFD Sbjct: 301 LPTIRAEVQV--TEPTGPDTLVFVNLNETKVCCRLAPDVAPAVGETLTLQFDPSKVLLFD 358 Query: 339 KKTG 342 KTG Sbjct: 359 AKTG 362 Lambda K H 0.318 0.136 0.383 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 368 Number of extensions: 10 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 2 Number of HSP's successfully gapped: 1 Length of query: 347 Length of database: 386 Length adjustment: 30 Effective length of query: 317 Effective length of database: 356 Effective search space: 112852 Effective search space used: 112852 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 49 (23.5 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory