GapMind for catabolism of small carbon sources

 

Aligments for a candidate for malK_Ss in Pseudomonas fluorescens FW300-N2E3

Align MalK, component of Maltose and maltooligosaccharide porter (characterized)
to candidate AO353_21860 AO353_21860 methionine ABC transporter ATP-binding protein

Query= TCDB::Q97UG5
         (617 letters)



>lcl|FitnessBrowser__pseudo3_N2E3:AO353_21860 AO353_21860 methionine
           ABC transporter ATP-binding protein
          Length = 328

 Score =  191 bits (484), Expect = 5e-53
 Identities = 115/314 (36%), Positives = 174/314 (55%), Gaps = 5/314 (1%)

Query: 9   LKVNELTAGYFNQDGFVIGVTNVNFEVYPNEIFAIAGESGCGKSTLAMAIYGLLKYPGVV 68
           L V EL+    N +  V  V  ++F++   EI  + GESG GK+    A+  LL  P + 
Sbjct: 6   LHVEELSVIAHNGERDVTLVDRLSFDLAEGEILGLVGESGSGKTMACRALMRLLPSPSLR 65

Query: 69  LRGH-VYLKDKDILSITQEELRKLRMKEFVYVPQFAMDALDPVAKIGDQMMRAAVSH-GV 126
           ++G  V L  K++L + +  +R +R +    + Q     LDP+ +IG+Q+      H G 
Sbjct: 66  VQGKAVQLAGKNLLQLDEAGMRAIRGRRLGMIFQNPSSHLDPLMRIGEQIGEGIRLHQGA 125

Query: 127 NVEEARKLIKEKLELVDLPY--NVVNMYPHELSGGMRQRVVIATSILLNPSLIILDEPTT 184
           +  EAR    E L  V +P     V+ Y HE SGGMRQR +IA ++  NP ++I DEPTT
Sbjct: 126 SKREARAQAIEVLRQVGIPDPPRRVDSYAHEFSGGMRQRAMIAVALACNPQVLIADEPTT 185

Query: 185 GLDVIVQYEILKDLKRIQRQLGVSLVIISHDISMLLMISDRVGIMYAGEIVEIGSKEEII 244
            LDV VQ +IL+ L  ++ Q G+S+++I+HD+ ++    D + +MYAG + E GSK E++
Sbjct: 186 ALDVTVQAQILRLLLDLRDQRGLSIILITHDLGVVAQTCDSIAVMYAGRLCEHGSKHELL 245

Query: 245 KRPSHPYTYLLISSLPSLVKRREKLLSIPGNPPLMLSKVPNSCRFYDRCPFKMEKCSTLN 304
            RP HPYT  LI   P+       L +I G PPL L  +P+ C F  RC  +  +C+ L 
Sbjct: 246 VRPRHPYTAGLIDCQPASSVGHAMLRTIAGQPPL-LDALPSGCSFNPRCLQQGSQCTMLL 304

Query: 305 PALGDIMDGHKARC 318
           P L  + +G +  C
Sbjct: 305 PDLQIMAEGQRVAC 318



 Score =  146 bits (369), Expect = 1e-39
 Identities = 92/243 (37%), Positives = 138/243 (56%), Gaps = 12/243 (4%)

Query: 378 INAVNDVSFELKKGTITALVGGSGHGKSTIAKILAGMIQQTS----GKII-LLGKDV--- 429
           +  V+ +SF+L +G I  LVG SG GK+   + L  ++   S    GK + L GK++   
Sbjct: 22  VTLVDRLSFDLAEGEILGLVGESGSGKTMACRALMRLLPSPSLRVQGKAVQLAGKNLLQL 81

Query: 430 SEYGVRNSMWYKENVQMIFQDPYSSLDPRHTVRWHVERPLLIHKKVSNKDQLLPKIIEVL 489
            E G+R     +  + MIFQ+P S LDP   +   +   + +H+  S K +   + IEVL
Sbjct: 82  DEAGMRAIRGRR--LGMIFQNPSSHLDPLMRIGEQIGEGIRLHQGAS-KREARAQAIEVL 138

Query: 490 KNVGLKPPEKYLYKYPHELSGGERQRVAIARATAVEPKVLVADEPVSMLDASLRAGILNL 549
           + VG+  P + +  Y HE SGG RQR  IA A A  P+VL+ADEP + LD +++A IL L
Sbjct: 139 RQVGIPDPPRRVDSYAHEFSGGMRQRAMIAVALACNPQVLIADEPTTALDVTVQAQILRL 198

Query: 550 IKKFK-KNGISILYITHDIATVNYIADEIMVIYKGRIVEKGNTYEVISNPSHEYTKRLIE 608
           +   + + G+SI+ ITHD+  V    D I V+Y GR+ E G+ +E++  P H YT  LI+
Sbjct: 199 LLDLRDQRGLSIILITHDLGVVAQTCDSIAVMYAGRLCEHGSKHELLVRPRHPYTAGLID 258

Query: 609 AVP 611
             P
Sbjct: 259 CQP 261


Lambda     K      H
   0.319    0.138    0.391 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 1
Number of Hits to DB: 470
Number of extensions: 18
Number of successful extensions: 8
Number of sequences better than 1.0e-02: 1
Number of HSP's gapped: 2
Number of HSP's successfully gapped: 2
Length of query: 617
Length of database: 328
Length adjustment: 33
Effective length of query: 584
Effective length of database: 295
Effective search space:   172280
Effective search space used:   172280
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 51 (24.3 bits)

This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.

Links

Downloads

Related tools

About GapMind

Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.

A candidate for a step is "high confidence" if either:

where "other" refers to the best ublast hit to a sequence that is not annotated as performing this step (and is not "ignored").

Otherwise, a candidate is "medium confidence" if either:

Other blast hits with at least 50% coverage are "low confidence."

Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:

GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).

For more information, see the paper from 2019 on GapMind for amino acid biosynthesis, the paper from 2022 on GapMind for carbon sources, or view the source code.

If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know

by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory