Align Mannitol-specific phosphotransferase enzyme IIA component (characterized, see rationale)
to candidate AO353_05485 AO353_05485 PTS fructose transporter subunit IIA
Query= uniprot:Q45420 (145 letters) >FitnessBrowser__pseudo3_N2E3:AO353_05485 Length = 953 Score = 104 bits (260), Expect = 3e-27 Identities = 52/133 (39%), Positives = 81/133 (60%) Query: 9 ENIVLHARVENKTEAIRLAGQILVNNGYVEDSYIDKMFEREALTSTYMGNFIAIPHGTED 68 E I + +K A+ L LVN+G V + Y+ + REA ST++G IAIPHGT D Sbjct: 7 EQISMGQSAVDKAAALHLLADTLVNDGLVAEGYLSGLQAREAQGSTFLGQGIAIPHGTPD 66 Query: 69 AKQFVKHSGISIIQIPDGVDFGDGNIVKLLIGIAGKNNEHLEILSKIAIVCSEVENVETM 128 + V +G+ ++Q P+GVD+GDG+IV L IGIA K++EHL +L + E + + + Sbjct: 67 TRDLVHTTGVRLLQFPEGVDWGDGHIVYLAIGIAAKSDEHLRLLQLLTRALGETDLGQAL 126 Query: 129 IKAATEEEILSIL 141 +A++ E +L +L Sbjct: 127 RRASSAEALLKLL 139 Lambda K H 0.316 0.135 0.365 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 241 Number of extensions: 12 Number of successful extensions: 1 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 145 Length of database: 953 Length adjustment: 29 Effective length of query: 116 Effective length of database: 924 Effective search space: 107184 Effective search space used: 107184 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 49 (23.5 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory