Align mannitol dehydrogenase (EC 1.1.1.255) (characterized)
to candidate AO353_28025 AO353_28025 alcohol dehydrogenase
Query= BRENDA::Q38707 (365 letters) >FitnessBrowser__pseudo3_N2E3:AO353_28025 Length = 343 Score = 216 bits (551), Expect = 6e-61 Identities = 120/338 (35%), Positives = 179/338 (52%), Gaps = 9/338 (2%) Query: 15 GWAARDTTGLLSPFKFSRRATGEKDVRLKVLFCGVCHSDHHMIHNNWGFTTYPIVPGHEI 74 GWAA L + + GE++V + V +CGVCHSD +I N WG + YP +PGHE+ Sbjct: 12 GWAATAAGAPLERYSYDPGPLGEEEVEVAVEYCGVCHSDQSLIDNEWGISQYPFIPGHEV 71 Query: 75 VGVVTEVGSKVEKVKVGDNVGIGCLVGSCRSCESCCDNRESHCENTIDTYGSIYFDGTMT 134 VG + VG++V ++VG VGIG GSC C SC C G++ + Sbjct: 72 VGSIVRVGTQVRGLEVGQRVGIGWYKGSCMHCSSCIGGSHHLC-------GTVQPTIVGS 124 Query: 135 HGGYSDTMVADEHFILRWPKNLPLDSGAPLLCAGITTYSPLKYYGLDKPGTKIGVVGLGG 194 +GG++D + + + L P L PL CAG T ++PL + + KP ++GVVG+GG Sbjct: 125 NGGFADRLRSHWAWALPIPSGLDPAMAGPLFCAGSTVFNPLVEFDV-KPTDRVGVVGIGG 183 Query: 195 LGHVAVKMAKAFGAQVTVIDISESKRKEALEKLGADSFLLNSDQEQMKGARSSLDGIIDT 254 LGH+A++ A+G +VT S SK+ EA +LGA + + ++D +K +LD ++ T Sbjct: 184 LGHLALRFLNAWGCEVTAFTSSLSKQDEA-RRLGAHNVVASTDSNALKSIAGTLDFLLVT 242 Query: 255 VPVNHPLAPLFDLLKPNGKLVMVGAPEKPFELPVFSLLKGRKLLGGTINGGIKETQEMLD 314 + + L+ G+L VGA + VF+LL +K L + G T ML+ Sbjct: 243 ANADLDWPAMLGTLRGKGRLHFVGAVPGAIPVHVFNLLPQQKSLSASPVGSPSTTATMLE 302 Query: 315 FAAKHNITADVEVIPMDYVNTAMERLVKSDVRYRFVID 352 F +H I VE PM VN A++ L RYR V+D Sbjct: 303 FCVRHQILPQVEHFPMSRVNEAIDHLRSGKARYRIVLD 340 Lambda K H 0.319 0.137 0.415 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 329 Number of extensions: 20 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 365 Length of database: 343 Length adjustment: 29 Effective length of query: 336 Effective length of database: 314 Effective search space: 105504 Effective search space used: 105504 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 49 (23.5 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory