Align Mannitol-1-phosphate 5-dehydrogenase; EC 1.1.1.17 (uncharacterized)
to candidate AO353_25900 AO353_25900 mannitol dehydrogenase
Query= curated2:O65992 (384 letters) >FitnessBrowser__pseudo3_N2E3:AO353_25900 Length = 491 Score = 99.8 bits (247), Expect = 2e-25 Identities = 69/225 (30%), Positives = 111/225 (49%), Gaps = 19/225 (8%) Query: 91 NNLKSTGELLRGFLKKRSEINDKPLDIIACENALFASDVLKKAILDGA---DEELKKYLE 147 N K+ L L KR +++C+N V +KA+L A D +L+ ++ Sbjct: 160 NAPKTVFGFLCAALAKRRAAGIPAFTLMSCDNLPHNGAVTRKALLAFAALRDADLRDWIG 219 Query: 148 KSVGFPNCTVDRIVP------NVDIEKELPID----VAVEDFYEWDIEKNKVKINN--KI 195 +V FPN VDRI P + + E ID V E F +W +E N V + Sbjct: 220 ANVSFPNAMVDRITPMTSSAHRLHLHDEHGIDDLWPVVCEPFVQWVLEDNFVNGRPAWEK 279 Query: 196 IGAEYVEKLDPYLERKLFLLNGAHATIAYLGYLKGYKYIHEAIKDKEINKIIVGFHS-EA 254 +G ++ + + PY E K+ LLNG+H + YLG+LKGY+++HE + D + + + + Sbjct: 280 VGVQFTDDVTPYEEMKIKLLNGSHLALTYLGFLKGYRFVHETMNDPLFVRYMRAYMDLDV 339 Query: 255 VQALSEKHKIDIQILKEYSNKLLKRFENEYLKDDVSRVGRDPMRK 299 L+ ID L +Y N L++RF N+ + D ++RV D K Sbjct: 340 TPQLAPVPGID---LTQYKNTLVERFSNQAIADQLARVCSDGSSK 381 Lambda K H 0.316 0.137 0.381 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 369 Number of extensions: 15 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 384 Length of database: 491 Length adjustment: 32 Effective length of query: 352 Effective length of database: 459 Effective search space: 161568 Effective search space used: 161568 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 51 (24.3 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory