Align TM1750, component of Probable mannose/mannoside porter. Induced by beta-mannan (Conners et al., 2005). Regulated by mannose-responsive regulator manR (characterized)
to candidate AO353_21855 AO353_21855 ABC transporter ATP-binding protein
Query= TCDB::Q9X272 (328 letters) >FitnessBrowser__pseudo3_N2E3:AO353_21855 Length = 323 Score = 244 bits (622), Expect = 3e-69 Identities = 133/300 (44%), Positives = 191/300 (63%), Gaps = 2/300 (0%) Query: 23 FPQGKRILKAVDGISIEIKEGETLGLVGESGCGKSTLGRTILKLLRPDGGKIFFEGKDIT 82 F ++ + AV+G+S+ + GE LGLVGESG GKS+LGR IL+L G++ F+G D+ Sbjct: 21 FKMNRQWVNAVNGVSLSLAAGEVLGLVGESGSGKSSLGRAILRLNDIAAGQVLFDGVDMA 80 Query: 83 NLNDKEMKPYRKKMQIIFQDPLGSLNPQMTVGRIIEDPLIIHKIGTKKERRKRVEELLDM 142 ++ R++ +IFQDP +LNP++++G I + L + + +RV+ELL Sbjct: 81 LGGKINIERLRRETAMIFQDPYAALNPRLSIGETIAEVLRVQRKVATPLIPRRVDELLTQ 140 Query: 143 VGIGREFINSFPHEFSGGQQQRIGIARALALNPKFIVCDEPVSALDVSIQAQIIDLLEEI 202 VG+ E + P SGGQ QR+GIARALA+ P+ I+ DE V+ALDVSIQ QII+LL E+ Sbjct: 141 VGLRSELASRKPGSLSGGQCQRVGIARALAIEPRLIIADECVAALDVSIQGQIINLLLEL 200 Query: 203 QQKMGISYLFIAHNLAVVEHISHKVAVMYLGKIVEYGDVDKIFLNPIHPYTRALLKSVPK 262 +Q+M ++ LFIAH+LA+++ + +VAVMYLG+IVE G V+ +F +P HPYT AL++S+P Sbjct: 201 RQRMNLAILFIAHDLAIIQRLCDRVAVMYLGQIVEEGPVEAVFSSPRHPYTVALIQSIPN 260 Query: 263 IPWDGQKQRFYSLKGELPSPIDLPKGCRFQTRCTEKKAICFEKEPELTEVEKNHFVSCHL 322 I + L GE PSP++ P GC F RC + IC E T K H SC L Sbjct: 261 IN-PTRPLPSMPLPGEPPSPLNRPSGCAFHPRCQHAQPICAETLAP-THNLKGHRYSCVL 318 Lambda K H 0.321 0.142 0.417 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 273 Number of extensions: 13 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 328 Length of database: 323 Length adjustment: 28 Effective length of query: 300 Effective length of database: 295 Effective search space: 88500 Effective search space used: 88500 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory