Align 6-hydroxycyclohex-1-ene-1-carbonyl-CoA dehydrogenase; EC 1.1.1.368 (characterized)
to candidate AO353_07635 AO353_07635 aldehyde dismutase
Query= SwissProt::O87871 (368 letters) >FitnessBrowser__pseudo3_N2E3:AO353_07635 Length = 399 Score = 78.6 bits (192), Expect = 3e-19 Identities = 60/197 (30%), Positives = 86/197 (43%), Gaps = 14/197 (7%) Query: 45 VVVAVAGCGVCHTDLGYYYDSVRTNHALPLALGHEISGRVVQAGANAAQW-LGRAVIVPA 103 V++ V +C +D + RT L LGHEI+G V++ G+ +G V VP Sbjct: 37 VILRVVSTNICGSD--QHMVRGRTTAQTGLVLGHEITGEVIEKGSGVENLQIGDLVSVPF 94 Query: 104 VMPCGTCELCTSGHGTICR--DQVMPGN--------DIQGGFASHVVVPARGLCPVDEAR 153 + CG C C H +C + PG D GG A + VP + Sbjct: 95 NVACGRCRSCKEQHTGVCLSVNPARPGGAYGYVDMGDWTGGQAEYAFVPYADFNLLKLPD 154 Query: 154 LAAAGLQLADVSVVADAVTTPYQAVLQAGVEPGDVAVVIGVGGVGGYAVQIANAFGASVV 213 A ++ D++ ++D + T Y + AGV PG V G G VG A A GA+VV Sbjct: 155 RDRAMEKIRDLTCLSDILPTGYHGAVTAGVGPGSTVYVAGAGPVGLAAAASARLLGAAVV 214 Query: 214 AI-DVDPAKLEMMSKHG 229 I DV+P +L G Sbjct: 215 IIGDVNPIRLAHAKAQG 231 Lambda K H 0.320 0.134 0.406 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 341 Number of extensions: 18 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 368 Length of database: 399 Length adjustment: 30 Effective length of query: 338 Effective length of database: 369 Effective search space: 124722 Effective search space used: 124722 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 50 (23.9 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory