Align phenylacetate-CoA ligase (EC 6.2.1.30) (characterized)
to candidate AO353_03310 AO353_03310 long-chain fatty acid--CoA ligase
Query= BRENDA::D3GE78 (556 letters) >lcl|FitnessBrowser__pseudo3_N2E3:AO353_03310 AO353_03310 long-chain fatty acid--CoA ligase Length = 566 Score = 194 bits (492), Expect = 1e-53 Identities = 160/526 (30%), Positives = 252/526 (47%), Gaps = 37/526 (7%) Query: 46 LTTHDLRLWSQRLAAGLRK-SGLQRGDRVLLFSGNDLFFPVVFLGVIMAGGIFTGANPTF 104 LT +L S AA L++ + LQ GDR+ + N L +P+ G I AG I NP + Sbjct: 50 LTYGELYELSGAFAAYLQQHTDLQPGDRIAVQLPNLLQYPIAVFGAIRAGLIVVNTNPLY 109 Query: 105 VARELAYQLQDSGATYLLCASNSLETGLEAAKQAKLPQSHIFAYDTS---------IYDG 155 ARE+ +Q DSGA L+C +N L A K H+ + + + + Sbjct: 110 TAREMEHQFNDSGAKALVCLANMAH--LAEAVVPKTGVKHVIVTEVADLLPPLKRLLINS 167 Query: 156 VTNPQKGC--AY-------WSDLLASEEEGAAFTWDELSTPALSSTTLALNYSSGTTGRP 206 V K AY ++D+L S+ G T + PA SS L Y+ GTTG Sbjct: 168 VIKYVKKMVPAYHLPKAVKFNDVL-SKGHGQPVTE---ANPA-SSDVAVLQYTGGTTGVA 222 Query: 207 KGVEISHRNYVANMLQYCHTASLHPDYKARLERSRWLCFLPMYHAMAQNIF-IAAALYRA 265 KG ++HRN VANM+Q + + + + LP+YH A +A L Sbjct: 223 KGAMLTHRNLVANMMQCRALMGSNLNEGCEI----LITPLPLYHIYAFTFHCMAMMLIGN 278 Query: 266 TPVYIMSKFDFVKMLEYTQRFRITDFILVPPVVVALAKHPAVGQYDLSSVELVGSGAAPL 325 + I + D M++ +++ + F+ + + VAL + A + D S +++ SG L Sbjct: 279 HNILISNPRDLPAMVKELSKWKFSGFVGLNTLFVALCNNEAFRKLDFSGLKITLSGGMAL 338 Query: 326 GREVCEEVEKLWPPGKINIKQGWGMTEATCSVTGWNPAEISTSASVGELNANCEAKIMFD 385 E + + I +G+GMTE T V NP + ++G + K++ D Sbjct: 339 QLAAAERWKAVTGCA---ICEGYGMTE-TSPVATVNPNQNIQIGTIGIPVPSTLCKVIDD 394 Query: 386 GVEVKERNSRGELWVRAPNVMKGYWRNEKATKETKTEDGWLLTGDIAFVDDDGKFHVVDR 445 + GEL V+ P VMKGYW+ ++AT E +GWL TGDIA + DG +VDR Sbjct: 395 AGVEQPLGEIGELCVKGPQVMKGYWQRQEATDEILDSEGWLKTGDIALIQPDGYMRIVDR 454 Query: 446 MKELIKVKGNQVAPAELEALLLEHPAISDVAVIGVV-INNDERPRAYVVLRPGQSATANE 504 K++I V G V P ELE +L P + A IGV + E + ++V +PG + T + Sbjct: 455 KKDMILVSGFNVYPNELEDVLATLPGVLQCAAIGVPDEKSGEAIKIFIVAKPGVTLTKEQ 514 Query: 505 IAHYLDNKVSAFKRITGGVVFLEAIPKNPSGKILRMKLREQAKEEL 550 + ++ V+ +K + + F +A+P GKILR +LR++ ++L Sbjct: 515 VMTHMRANVTGYK-VPRAIEFRDALPTTNVGKILRRELRDEELKKL 559 Lambda K H 0.319 0.134 0.403 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 688 Number of extensions: 31 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 2 Number of HSP's successfully gapped: 2 Length of query: 556 Length of database: 566 Length adjustment: 36 Effective length of query: 520 Effective length of database: 530 Effective search space: 275600 Effective search space used: 275600 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 53 (25.0 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see the paper from 2019 on GapMind for amino acid biosynthesis, the preprint on GapMind for carbon sources, or view the source code.
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory