Align Enoyl-CoA hydratase; EC 4.2.1.17 (characterized, see rationale)
to candidate AO353_03780 AO353_03780 enoyl-CoA hydratase
Query= uniprot:A0A2Z5MCI7 (262 letters) >FitnessBrowser__pseudo3_N2E3:AO353_03780 Length = 249 Score = 107 bits (267), Expect = 2e-28 Identities = 77/244 (31%), Positives = 120/244 (49%), Gaps = 13/244 (5%) Query: 17 LVLTLSNPGARNALHPDMYAAGIEALDSVERDPSIRAVVITGADNFFCAGGNLNRLLENR 76 L L L+ P +NAL MY+ +AL + DP I A++ITG F AG ++ LE Sbjct: 14 LTLRLNRPDKKNALTRAMYSQLADALLQADADPEINAILITGTRECFTAGNDIADFLEEP 73 Query: 77 AKDPSVQAQSIDLLAEWISALRLSSKPVIAAVDGAAAGAGFSLALACDLIVAADDAKFVM 136 D + + +++ L KPVIAAV GAA G G +L L CDL+ + DAK M Sbjct: 74 PSDLTSP------VFQFMRNLLECRKPVIAAVAGAAVGIGTTLLLHCDLVYISADAKLRM 127 Query: 137 SYARVGLTPDGGGSWFLAQALPRQLATEVLIEGKPIGAARLHELGVVNKLTKPGTARDAA 196 + +GL P+ G S L + L + A E+L+ G+ + G+ + G +AA Sbjct: 128 PFVNLGLCPEFGSSLILPRLLGQAKAAELLLLGEGFNGEQAAAWGIATQALPTG---EAA 184 Query: 197 VAWADELG----KISPNSVARIKTLVCAAGTQPLSEHLVAERDNFVASLHHREGLEGISA 252 +A A E+ ++P +V K L+ A + L + + E + FV L E + +S Sbjct: 185 LAKAREMALRFETLAPEAVRISKQLMKAPDREQLRKAIEEEGNLFVQRLRSPEAIAALSG 244 Query: 253 FLEK 256 F+ + Sbjct: 245 FINR 248 Lambda K H 0.317 0.132 0.377 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 120 Number of extensions: 3 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 262 Length of database: 249 Length adjustment: 24 Effective length of query: 238 Effective length of database: 225 Effective search space: 53550 Effective search space used: 53550 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory