Align Putative branched-chain alpha keto acid dehydrogenase E1 subunit beta (characterized, see rationale)
to candidate AO353_15580 AO353_15580 2-oxoisovalerate dehydrogenase
Query= uniprot:G1UHX5 (328 letters) >FitnessBrowser__pseudo3_N2E3:AO353_15580 Length = 328 Score = 280 bits (715), Expect = 5e-80 Identities = 156/322 (48%), Positives = 205/322 (63%), Gaps = 5/322 (1%) Query: 3 EITMAKALNTALRDALRDDPRTILFGEDIGALGGVFRITDGLAAEFGDERCFDTPLAESA 62 ++T+ +A+N AL A+R+D I+ GED+G GGVFR T GL FG +R DTPLAE+ Sbjct: 5 KVTLLEAINLALHRAMREDENVIVLGEDVGVNGGVFRATLGLRDSFGFKRVIDTPLAETM 64 Query: 63 ILGTAVGMAMYGYRPVVEMQFDAFAYPAFEQLVSHVAKLRNRTRGAIGLPLTIRIPYGGG 122 + G +GMA G +PV+E+QF F Y A E LVSH +++RNRTRG I P+ +R P G G Sbjct: 65 LGGLVIGMAAQGLKPVLEIQFMGFIYAAMEHLVSHASRMRNRTRGRITCPMVLRTPMGAG 124 Query: 123 IGGVEHHSDSSEIYYMATPGLTVVTPATAADAYSLLRRSIASPDPVVFLEPKRLYWRKEA 182 I EHHS+S+E + PGL VV P++ A AY LL +I PDPV+FLEP RLY R Sbjct: 125 IRAPEHHSESTEALFAHIPGLRVVIPSSPARAYGLLLAAIDDPDPVIFLEPTRLY-RMNP 183 Query: 183 LGLPVDTG---PLGSAVIRRHGTHATLIAYGPAVTTALEAAEAAAEHGWDLEVIDLRTLM 239 L +D G PL + R G+ TLI++G +V L+AA+A AE G EVID+ ++ Sbjct: 184 QPL-IDDGKRLPLDTCFTLREGSDITLISWGASVMETLQAADALAEQGISAEVIDVASIK 242 Query: 240 PLDDATVCASVRRTGRAVVVHEAHGFAGPGAEIAARITERCFYHLEAPVRRVTGFDVPYP 299 PLD T+ ASVR+TGR V+VHEA G GAEIAA + ER L+AP+ RVT D+P P Sbjct: 243 PLDLDTLEASVRKTGRCVIVHEAPRTCGVGAEIAASLYERALLDLQAPILRVTAPDIPPP 302 Query: 300 PPLLERHYLPGVDRILDAVASL 321 E Y+P V+ IL A S+ Sbjct: 303 LYRQELLYMPNVEDILHACDSV 324 Lambda K H 0.322 0.138 0.418 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 302 Number of extensions: 13 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 328 Length of database: 328 Length adjustment: 28 Effective length of query: 300 Effective length of database: 300 Effective search space: 90000 Effective search space used: 90000 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.9 bits) S2: 49 (23.5 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory