Align BadH (characterized)
to candidate AO353_01660 AO353_01660 short-chain dehydrogenase
Query= metacyc::MONOMER-893 (255 letters) >FitnessBrowser__pseudo3_N2E3:AO353_01660 Length = 253 Score = 142 bits (357), Expect = 9e-39 Identities = 89/248 (35%), Positives = 136/248 (54%), Gaps = 6/248 (2%) Query: 7 KTAVITGGGGGIGGATCRRFAQEGAKIAVFDLNLDAAEKVAGAIRDAGGTAEAVRCDIAD 66 + A++TG GIG AT + FA EG K+ V DL++ E A IR AGG A V+C++ Sbjct: 8 QVALVTGAAAGIGRATAQAFAAEGLKVVVADLDVAGGEGTAELIRAAGGEAVFVQCNVTQ 67 Query: 67 RTSVDAAIATTTTTLGPVDILVNNAGWDIFK-PFTKTEPGEWERLIAINLTGALHMHHAV 125 + V +A +T G +D NNAG +I K + E++ ++ +N+ G Sbjct: 68 ESDVQNLMAKAVSTYGRLDYAFNNAGIEIEKGKLAEGTLDEFDAIMGVNVKGVWLCMKYQ 127 Query: 126 LPGMVERRHGRIVNIASDAARVGSSGEAVYAACKGGLVAFSKTLAREHARHGITVNVVCP 185 LP M+ + G IVN AS A + ++YAA K ++ +K+ A E+A+ I VN VCP Sbjct: 128 LPLMLAQGGGAIVNTASVAGLGAAPKMSIYAASKHAVIGLTKSAAIEYAKKKIRVNAVCP 187 Query: 186 GPTDTALLADVTSGAANPEKLIEAFTKAI-PLGRLGKPDDLAGAIAFFGSDDAGFITGQV 244 DT + + A+P+K F A+ P+GR+GK +++A A+ + SD A F TG Sbjct: 188 AVIDTDMFR--RAYEADPKK--ADFAAAMHPVGRIGKVEEIASAVLYLCSDGAAFTTGHS 243 Query: 245 LSVSGGLT 252 L+V GG+T Sbjct: 244 LAVDGGVT 251 Lambda K H 0.318 0.135 0.398 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 145 Number of extensions: 11 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 255 Length of database: 253 Length adjustment: 24 Effective length of query: 231 Effective length of database: 229 Effective search space: 52899 Effective search space used: 52899 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory