Align BadK (characterized)
to candidate AO353_24830 AO353_24830 enoyl-CoA hydratase
Query= metacyc::MONOMER-943 (258 letters) >FitnessBrowser__pseudo3_N2E3:AO353_24830 Length = 263 Score = 114 bits (285), Expect = 2e-30 Identities = 84/265 (31%), Positives = 126/265 (47%), Gaps = 26/265 (9%) Query: 6 ILTETQGRVGIITLNRPDVLNALNDALMDALGGALLAFDADDGIGAIVIAGNTRAFAAGA 65 +L++ + V ITLNR NAL+ + L L F+AD + +V+ G+ R+F AGA Sbjct: 7 LLSQVEAGVAWITLNRTAQRNALDIPTLKNLHALLDDFNADPAVRVVVLTGSGRSFCAGA 66 Query: 66 DIASMAAWSYSDVYGSNFITRNW--------ETIRQIRKPVLAAVAGLAYGGGCELALAC 117 D+A W+ ++ G+ + W + + KP +AA+ G A G G +L L C Sbjct: 67 DLAE---WAEAEARGA-LESYGWTETAHALMSRLYSLDKPTIAAINGTAVGAGMDLTLCC 122 Query: 118 DIVIAGRSAKFALPEIKLGLLPGAGGTQRLPRAIGKAKAMDMCLSARPLNAEEADRYGLV 177 D+ IAG+SA+F + P AG + LPR IG +A + A+ A GLV Sbjct: 123 DLRIAGQSARFKAGYTSMAYSPDAGASWHLPRLIGTEQAKRLLFLDELWGADRALAAGLV 182 Query: 178 SRVVDDDRLRDETVALATTIAAFSAPALMALKESLNRAFESTLAEGILFERRELHARFA- 236 S V D++L LAT +A A K+ + + +L E +LHA A Sbjct: 183 SEVCADEQLLGAASELATRLANGPTFAFAQTKKLMREGAQRSLPE-------QLHAELAA 235 Query: 237 ------SADAREGIQAFLEKRAPCF 255 S D E ++A +EKR P F Sbjct: 236 GLLCGRSEDGAEALRAAMEKRPPQF 260 Lambda K H 0.321 0.135 0.389 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 120 Number of extensions: 6 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 258 Length of database: 263 Length adjustment: 25 Effective length of query: 233 Effective length of database: 238 Effective search space: 55454 Effective search space used: 55454 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.9 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory