Align Fumarylacetoacetase; FAA; Beta-diketonase; Fumarylacetoacetate hydrolase; EC 3.7.1.2 (characterized)
to candidate AO353_15555 AO353_15555 fumarylacetoacetase
Query= SwissProt::P16930 (419 letters) >FitnessBrowser__pseudo3_N2E3:AO353_15555 Length = 434 Score = 371 bits (952), Expect = e-107 Identities = 207/420 (49%), Positives = 262/420 (62%), Gaps = 18/420 (4%) Query: 10 SDFPIHNLPYGVFSTRGDPRPRIGVAIGDQILDL--SIIKHLFTGPVLSKHQDVFNQPTL 67 +DFP+ NLP GVFST+G PR GVAIG+ I DL ++ LF G + + L Sbjct: 18 TDFPLQNLPLGVFSTKGSA-PRSGVAIGEHIFDLEAALEAGLFDGAARAA-VEATRGGQL 75 Query: 68 NSFMGLGQAAWKEARVFLQNLLSVSQARLRDDTELRKCAFISQAS-ATMHLPATIGDYTD 126 N+F LG+ A R L L + LR E + + A+ MHLPA I DYTD Sbjct: 76 NAFFDLGRGARVALRERLLELFTEGST-LRGKIEAQGAKLLPLAADCQMHLPAKINDYTD 134 Query: 127 FYSSRQHATNVGIMFRDKENALMPNWLHLPVGYHGRASSVVVSGTPIRRPMGQMKPDDSK 186 FY +HA NVG +FR +N L+PN+ ++P+GYHGRAS++ SGT +RRP GQ P Sbjct: 135 FYVGIEHAQNVGKLFRP-DNPLLPNYKYVPIGYHGRASTIRPSGTDVRRPKGQTLPAGQT 193 Query: 187 PPVYGACKLLDMELEMAFFVGPGNRLGEPIPISKAHEHIFGMVLMNDWSARDIQKWEYVP 246 P +G C LD ELE+ ++G GN +G+ I I A EHI G L+NDWSARDIQ WEY P Sbjct: 194 EPTFGPCARLDYELELGIWIGQGNEMGDSIAIGDAAEHIAGFCLLNDWSARDIQAWEYQP 253 Query: 247 LGPFLGKSFGTTVSPWVVPMDALMPF--AVP-NPKQDPRPLPYLCHDEPY---TFDINLS 300 LGPFL KSF T++SPWVV +AL PF A P P+ DP+PLPYL FDI L Sbjct: 254 LGPFLSKSFITSISPWVVTAEALEPFRRAQPARPEGDPQPLPYLFDKRDQAAGAFDIELE 313 Query: 301 VNLKGEGMSQ----AATICKSNFKYMYWTMLQQLTHHSVNGCNLRPGDLLASGTISGPEP 356 V L E M + A + SN +YMYWT+ Q + HHSVNGC L+ GDL SGT+SGPE Sbjct: 314 VLLLTEAMREQNLPAHRLTLSNTQYMYWTVAQMVAHHSVNGCQLQAGDLFGSGTLSGPEN 373 Query: 357 ENFGSMLELSWKGTKPIDLGNGQTRKFLLDGDEVIITGYCQGDGY-RIGFGQCAGKVLPA 415 FGS+LE++ G KPI+L +G+ RKFL DGDE+I+ C DG+ IGFG+C GK+LPA Sbjct: 374 GQFGSLLEITEGGKKPIELASGEVRKFLEDGDEIILRARCSRDGFASIGFGECRGKILPA 433 Lambda K H 0.321 0.139 0.440 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 600 Number of extensions: 39 Number of successful extensions: 7 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 419 Length of database: 434 Length adjustment: 32 Effective length of query: 387 Effective length of database: 402 Effective search space: 155574 Effective search space used: 155574 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 51 (24.3 bits)
Align candidate AO353_15555 AO353_15555 (fumarylacetoacetase)
to HMM TIGR01266 (fahA: fumarylacetoacetase (EC 3.7.1.2))
# hmmsearch :: search profile(s) against a sequence database # HMMER 3.3.1 (Jul 2020); http://hmmer.org/ # Copyright (C) 2020 Howard Hughes Medical Institute. # Freely distributed under the BSD open source license. # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query HMM file: ../tmp/path.carbon/TIGR01266.hmm # target sequence database: /tmp/gapView.2528.genome.faa # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: TIGR01266 [M=420] Accession: TIGR01266 Description: fum_ac_acetase: fumarylacetoacetase Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 1.4e-196 639.3 0.0 1.6e-196 639.1 0.0 1.0 1 lcl|FitnessBrowser__pseudo3_N2E3:AO353_15555 AO353_15555 fumarylacetoacetase Domain annotation for each sequence (and alignments): >> lcl|FitnessBrowser__pseudo3_N2E3:AO353_15555 AO353_15555 fumarylacetoacetase # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 639.1 0.0 1.6e-196 1.6e-196 1 419 [. 9 433 .. 9 434 .] 0.97 Alignments for each domain: == domain 1 score: 639.1 bits; conditional E-value: 1.6e-196 TIGR01266 1 sfvavak.nsdfplqnlPyGvfstkadssrrigvaiGdqildlskiaaaglfeglalkehqevfk 64 s+va+a+ ++dfplqnlP+Gvfs ++s +r gvaiG++i+dl+++++aglf+g a++++ e+++ lcl|FitnessBrowser__pseudo3_N2E3:AO353_15555 9 SWVASANgHTDFPLQNLPLGVFS-TKGSAPRSGVAIGEHIFDLEAALEAGLFDG-AARAAVEATR 71 8******9***************.57899*************************.999******* PP TIGR01266 65 estlnaflalgrparkevrerlqkllsesaevlrdnaalrkealla.qaeatmhlPaqiGdytdf 128 ++ lnaf+ lgr ar+++rerl++l++ + +lr + + + ll+ +a+++mhlPa+i dytdf lcl|FitnessBrowser__pseudo3_N2E3:AO353_15555 72 GGQLNAFFDLGRGARVALRERLLELFT-EGSTLRGKIEAQGAKLLPlAADCQMHLPAKINDYTDF 135 **************************9.6677899998887777662689*************** PP TIGR01266 129 yssirhatnvGilfrgkdnallPnykhlPvgyhGrassvvvsGtelrrPvGqikadnakePvfgp 193 y++i+ha+nvG+lfr +dn+llPnyk++P+gyhGras+++ sGt++rrP+Gq+++++ eP+fgp lcl|FitnessBrowser__pseudo3_N2E3:AO353_15555 136 YVGIEHAQNVGKLFR-PDNPLLPNYKYVPIGYHGRASTIRPSGTDVRRPKGQTLPAGQTEPTFGP 199 ***************.************************************************* PP TIGR01266 194 ckkldlelelaffvgtenelGeavpiekaeehifGvvllndwsardiqaweyvPlGPflaksfat 258 c++ld+elel++++g++ne+G+++ i a+ehi+G++llndwsardiqawey+PlGPfl+ksf+t lcl|FitnessBrowser__pseudo3_N2E3:AO353_15555 200 CARLDYELELGIWIGQGNEMGDSIAIGDAAEHIAGFCLLNDWSARDIQAWEYQPLGPFLSKSFIT 264 ***************************************************************** PP TIGR01266 259 tvsPwvvsiealePfrvaq.lePeqdpkplpylredr..adtafdielevslkteGlae....aa 316 ++sPwvv++ealePfr+aq ++Pe+dp+plpyl ++r a afdielev l te ++e a+ lcl|FitnessBrowser__pseudo3_N2E3:AO353_15555 265 SISPWVVTAEALEPFRRAQpARPEGDPQPLPYLFDKRdqAAGAFDIELEVLLLTEAMREqnlpAH 329 *******************9***************99556789***************9899889 PP TIGR01266 317 visrsnakslywtlkqqlahhsvnGcnlraGdllgsGtisGkeeeafGsllelsakGkkevklad 381 +++ sn++ +ywt++q++ahhsvnGc+l+aGdl+gsGt+sG+e+++fGslle++ +Gkk+++la+ lcl|FitnessBrowser__pseudo3_N2E3:AO353_15555 330 RLTLSNTQYMYWTVAQMVAHHSVNGCQLQAGDLFGSGTLSGPENGQFGSLLEITEGGKKPIELAS 394 ***************************************************************** PP TIGR01266 382 getrkfledGdevilrgvckkeGvr.vGfGecaGkvlpa 419 ge+rkfledGde+ilr++c ++G +GfGec+Gk+lpa lcl|FitnessBrowser__pseudo3_N2E3:AO353_15555 395 GEVRKFLEDGDEIILRARCSRDGFAsIGFGECRGKILPA 433 ***********************988************8 PP Internal pipeline statistics summary: ------------------------------------- Query model(s): 1 (420 nodes) Target sequences: 1 (434 residues searched) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.02u 0.00s 00:00:00.02 Elapsed: 00:00:00.02 # Mc/sec: 7.21 // [ok]
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory