Align High-affinity branched-chain amino acid ABC transporter ATP-binding protein LivG (characterized, see rationale)
to candidate AO353_13355 AO353_13355 ABC transporter ATP-binding protein
Query= uniprot:A0A159ZWS6 (255 letters) >FitnessBrowser__pseudo3_N2E3:AO353_13355 Length = 291 Score = 290 bits (741), Expect = 3e-83 Identities = 149/279 (53%), Positives = 196/279 (70%), Gaps = 30/279 (10%) Query: 5 ILKVENLSMRFGGLLAVNGVALTVKEKQVVALIGPNGAGKTTVFNCLTGFYQPTGGTILL 64 IL VENL M FGG+ A++ V+L VK + ALIGPNGAGKTTVFNCLTGFY+ +GG I L Sbjct: 6 ILSVENLMMHFGGIKALSDVSLKVKRNSIFALIGPNGAGKTTVFNCLTGFYKASGGHIEL 65 Query: 65 D------------GEPIQGLP------------------GHHIARKGVVRTFQNVRLFKD 94 + GEP + H I R G+ RTFQN+RLF++ Sbjct: 66 NTRGVKTNVIKMLGEPFKATDFVSPKRFVNRLHYKMFGGTHLINRAGLARTFQNIRLFRE 125 Query: 95 MTAVENLLIAQHRHLNTNFFAGLFKTPAFRKSEREAMEYAEYWLDKVNLTEFANRPAGTL 154 M+ +ENLL+AQH +N N +G+ T +RK+E +A+++A YWL+ V+L + ANR AG L Sbjct: 126 MSVIENLLVAQHMWVNRNLVSGILNTKGYRKAESDALDHAFYWLEVVDLVDCANRLAGEL 185 Query: 155 AYGQQRRLEIARCMMTRPRILMLDEPAAGLNPKETEDLKALIGVLREEHNVTVLLIEHDM 214 +YGQQRRLEIAR M TRP+I+ LDEPAAGLNP+ETE L A+I LR++H++TV+LIEHDM Sbjct: 186 SYGQQRRLEIARAMCTRPKIICLDEPAAGLNPQETEALSAMIRHLRDDHDITVVLIEHDM 245 Query: 215 KLVMSISDHIVVINQGTPLADGTPEQIRDNPEVIKAYLG 253 +VMSISDHIVV++ G +A+G P+ IR++P+VI AYLG Sbjct: 246 GMVMSISDHIVVLDHGNVIAEGNPQAIRNDPKVIAAYLG 284 Lambda K H 0.321 0.138 0.398 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 242 Number of extensions: 8 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 255 Length of database: 291 Length adjustment: 25 Effective length of query: 230 Effective length of database: 266 Effective search space: 61180 Effective search space used: 61180 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory