Align High-affinity branched-chain amino acid transport ATP-binding protein LivG aka B3455, component of Leucine; leucine/isoleucine/valine porter (characterized)
to candidate AO353_13360 AO353_13360 ABC transporter ATP-binding protein
Query= TCDB::P0A9S7 (255 letters) >FitnessBrowser__pseudo3_N2E3:AO353_13360 Length = 238 Score = 122 bits (305), Expect = 9e-33 Identities = 81/253 (32%), Positives = 134/253 (52%), Gaps = 17/253 (6%) Query: 1 MSQPLLSVNGLMMRFGGLLAVNNVNLELYPQEIVSLIGPNGAGKTTVFNCLTGFYKPTGG 60 M+QP+L + + + +G + A+ V+L + E VSLIG NGAGK+T+ + G + GG Sbjct: 1 MTQPILELKAIDVFYGPIQALKKVSLHINEGETVSLIGSNGAGKSTLLMSIFGQPRAAGG 60 Query: 61 TILLRDQHLEGLPGQQIARMGVVRTFQHVRLFREMTVIENLLVAQHQQLKTGLFSGLLKT 120 I+ R + IA G+ ++ + R+F +MTV ENLL+ Sbjct: 61 QIVYRGVDITHKSSHYIASNGIAQSPEGRRVFPDMTVEENLLMG--------------TI 106 Query: 121 PSFRRAQSEALDRAATWLERIGLLEHANRQASNLAYGDQRRLEIARCMVTQPEILMLDEP 180 P + +E + R R L E N++A ++ G+Q+ L IAR ++++P++L+LDEP Sbjct: 107 PIGDQYATEDMQRMFELFPR--LKERRNQRAMTMSGGEQQMLAIARALMSRPKLLLLDEP 164 Query: 181 AAGLNPKETKELDELIAELRNHHNTTILLIEHDMKLVMGISDRIYVVNQGTPLANGTPEQ 240 + GL P K++ + EL TI L+E + + +SDR YV+ G +GT ++ Sbjct: 165 SLGLAPIVVKQIFATLRELAG-TGMTIFLVEQNANHALKLSDRAYVMVNGEIRLSGTGKE 223 Query: 241 IRNNPDVIRAYLG 253 + N +V AYLG Sbjct: 224 LLVNEEVRNAYLG 236 Lambda K H 0.320 0.137 0.395 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 174 Number of extensions: 14 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 255 Length of database: 238 Length adjustment: 24 Effective length of query: 231 Effective length of database: 214 Effective search space: 49434 Effective search space used: 49434 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 46 (22.3 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory