GapMind for catabolism of small carbon sources

 

Aligments for a candidate for livM in Pseudomonas fluorescens FW300-N2E3

Align High-affinity branched-chain amino acid ABC transporter permease LivM (characterized, see rationale)
to candidate AO353_13350 AO353_13350 branched-chain amino acid ABC transporter permease

Query= uniprot:A0A159ZYE0
         (418 letters)



>lcl|FitnessBrowser__pseudo3_N2E3:AO353_13350 AO353_13350
           branched-chain amino acid ABC transporter permease
          Length = 432

 Score =  400 bits (1027), Expect = e-116
 Identities = 216/418 (51%), Positives = 286/418 (68%), Gaps = 9/418 (2%)

Query: 3   RHLKSALFSALLVWAVAYPVLGLKLTIVGINLEVHGTSPAILAT-IAVCSLLMFLRVLFS 61
           + L   + + L+   V  P++G+ L     NL+    +  + A  I   +L +F++    
Sbjct: 13  KSLIDTVLAGLIALIVFGPIVGVVLEGYSYNLQPTRVAWMVGAVMIGRLALSLFMQTAKG 72

Query: 62  TQISAMWKS-SPGLPVIPAKASNFLTLPTTQRWIVLALIVGALVWPFFGSRGAVDIATLI 120
            ++   ++    G+ V+     + L      R+I+ ALIV A+V+P F  +  + +  L 
Sbjct: 73  EKVQQRFEIVGSGVHVLAPDFKSRL------RFIIPALIVIAIVFPVFADKYLLTVVILG 126

Query: 121 LIYVMLGLGLNIVVGLAGLLDLGYVGFYAVGAYSYALLSHYFGLSFWICLPIAGMMAATF 180
           LIYV+LGLGLNIVVGLAGLLDLGYV FYA+GAY  AL  HY GL FW  LP++ +MAA  
Sbjct: 127 LIYVLLGLGLNIVVGLAGLLDLGYVAFYAIGAYGLALGYHYLGLGFWTVLPLSALMAALA 186

Query: 181 GFLLGFPVLRLRGDYLAIVTLGFGEIIRLFLRNLTDITGGPNGISNIEKPTFFGLTFERK 240
           G +LGFPVLR+ GDYLAIVTLGFGEIIRL L N    TGGPNG+  +  P+FFG+ F R 
Sbjct: 187 GCILGFPVLRMHGDYLAIVTLGFGEIIRLILTNWLSFTGGPNGMP-VPSPSFFGIEFTRV 245

Query: 241 AAEGLQTFHEYFGLEYNSINKVIFLYLVALLLALAALFVINRLLRMPIGRAWEALREDEI 300
           A +G   FHE+FG EYN   K +F+Y V  L+ +  L++ +RL RMP+GRAWEALREDEI
Sbjct: 246 AKDGGIPFHEFFGTEYNPNIKFMFIYAVLFLVVMLVLYIKHRLTRMPVGRAWEALREDEI 305

Query: 301 ACRALGLNPTVIKLSAFTLGAAFAGFAGSFFAARQGLVTPESFTFIESAIILAIVVLGGM 360
           ACRA+GLN  ++KLSAFTLGA+ AG AG FFA+ QG V P SFTF ESA+ILAIVVLGGM
Sbjct: 306 ACRAMGLNHVLVKLSAFTLGASTAGLAGVFFASYQGFVNPTSFTFFESALILAIVVLGGM 365

Query: 361 GSQLGVILAAIVMILLPEMMREFSEYRMLMFGALMVLMMIWRPQGLLPMQRPHMELRK 418
           GS +GV++AA V+ + PE++R F+EYR+L+FG LMVLMMIW+P+GL+ + R  +  RK
Sbjct: 366 GSTVGVVIAAFVLTVAPELLRGFAEYRVLLFGILMVLMMIWKPRGLIRISRTGVTPRK 423


Lambda     K      H
   0.331    0.145    0.439 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 1
Number of Hits to DB: 645
Number of extensions: 38
Number of successful extensions: 3
Number of sequences better than 1.0e-02: 1
Number of HSP's gapped: 1
Number of HSP's successfully gapped: 1
Length of query: 418
Length of database: 432
Length adjustment: 32
Effective length of query: 386
Effective length of database: 400
Effective search space:   154400
Effective search space used:   154400
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 15 ( 7.2 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 40 (21.9 bits)
S2: 51 (24.3 bits)

This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.

Links

Downloads

Related tools

About GapMind

Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer. Ublast hits may be split across two different proteins.

A candidate for a step is "high confidence" if either:

where "other" refers to the best ublast hit to a sequence that is not annotated as performing this step (and is not "ignored").

Otherwise, a candidate is "medium confidence" if either:

Other blast hits with at least 50% coverage are "low confidence."

Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. Gaps may be due to:

GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).

For more information, see the paper from 2019 on GapMind for amino acid biosynthesis, or view the source code.

If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know

by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory