Align High-affinity branched-chain amino acid ABC transporter permease LivM (characterized, see rationale)
to candidate AO353_13350 AO353_13350 branched-chain amino acid ABC transporter permease
Query= uniprot:A0A159ZYE0 (418 letters) >FitnessBrowser__pseudo3_N2E3:AO353_13350 Length = 432 Score = 400 bits (1027), Expect = e-116 Identities = 216/418 (51%), Positives = 286/418 (68%), Gaps = 9/418 (2%) Query: 3 RHLKSALFSALLVWAVAYPVLGLKLTIVGINLEVHGTSPAILAT-IAVCSLLMFLRVLFS 61 + L + + L+ V P++G+ L NL+ + + A I +L +F++ Sbjct: 13 KSLIDTVLAGLIALIVFGPIVGVVLEGYSYNLQPTRVAWMVGAVMIGRLALSLFMQTAKG 72 Query: 62 TQISAMWKS-SPGLPVIPAKASNFLTLPTTQRWIVLALIVGALVWPFFGSRGAVDIATLI 120 ++ ++ G+ V+ + L R+I+ ALIV A+V+P F + + + L Sbjct: 73 EKVQQRFEIVGSGVHVLAPDFKSRL------RFIIPALIVIAIVFPVFADKYLLTVVILG 126 Query: 121 LIYVMLGLGLNIVVGLAGLLDLGYVGFYAVGAYSYALLSHYFGLSFWICLPIAGMMAATF 180 LIYV+LGLGLNIVVGLAGLLDLGYV FYA+GAY AL HY GL FW LP++ +MAA Sbjct: 127 LIYVLLGLGLNIVVGLAGLLDLGYVAFYAIGAYGLALGYHYLGLGFWTVLPLSALMAALA 186 Query: 181 GFLLGFPVLRLRGDYLAIVTLGFGEIIRLFLRNLTDITGGPNGISNIEKPTFFGLTFERK 240 G +LGFPVLR+ GDYLAIVTLGFGEIIRL L N TGGPNG+ + P+FFG+ F R Sbjct: 187 GCILGFPVLRMHGDYLAIVTLGFGEIIRLILTNWLSFTGGPNGMP-VPSPSFFGIEFTRV 245 Query: 241 AAEGLQTFHEYFGLEYNSINKVIFLYLVALLLALAALFVINRLLRMPIGRAWEALREDEI 300 A +G FHE+FG EYN K +F+Y V L+ + L++ +RL RMP+GRAWEALREDEI Sbjct: 246 AKDGGIPFHEFFGTEYNPNIKFMFIYAVLFLVVMLVLYIKHRLTRMPVGRAWEALREDEI 305 Query: 301 ACRALGLNPTVIKLSAFTLGAAFAGFAGSFFAARQGLVTPESFTFIESAIILAIVVLGGM 360 ACRA+GLN ++KLSAFTLGA+ AG AG FFA+ QG V P SFTF ESA+ILAIVVLGGM Sbjct: 306 ACRAMGLNHVLVKLSAFTLGASTAGLAGVFFASYQGFVNPTSFTFFESALILAIVVLGGM 365 Query: 361 GSQLGVILAAIVMILLPEMMREFSEYRMLMFGALMVLMMIWRPQGLLPMQRPHMELRK 418 GS +GV++AA V+ + PE++R F+EYR+L+FG LMVLMMIW+P+GL+ + R + RK Sbjct: 366 GSTVGVVIAAFVLTVAPELLRGFAEYRVLLFGILMVLMMIWKPRGLIRISRTGVTPRK 423 Lambda K H 0.331 0.145 0.439 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 645 Number of extensions: 38 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 418 Length of database: 432 Length adjustment: 32 Effective length of query: 386 Effective length of database: 400 Effective search space: 154400 Effective search space used: 154400 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.2 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.9 bits) S2: 51 (24.3 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory