Align glutathione transferase (EC 2.5.1.18); maleylacetoacetate isomerase (EC 5.2.1.2) (characterized)
to candidate AO353_10285 AO353_10285 glutathione S-transferase
Query= BRENDA::O43708 (216 letters) >FitnessBrowser__pseudo3_N2E3:AO353_10285 Length = 207 Score = 67.4 bits (163), Expect = 2e-16 Identities = 57/193 (29%), Positives = 88/193 (45%), Gaps = 5/193 (2%) Query: 8 LYSYFRSSCSWRVRIALALKGIDYKTVPINLIKDRGQQFSKDFQALNPMKQVPTLKIDGI 67 LY++ RS + RV + L+L + + + ++L K +Q DF ALN QVP + G+ Sbjct: 6 LYNFPRSGHAHRVELMLSLLELPTELIFVDLAKGAHKQ--PDFLALNAFGQVPVIDDQGV 63 Query: 68 TIHQSLAIIEYLEEMRPTPRLLPQDPKKRASVRMISDLIAGGIQPLQNLSVLKQVGEEMQ 127 + S AI+ YL + R LP DP A V+ + AG I ++ + + Sbjct: 64 VLADSNAILVYLAQKYGKGRWLPADPVGAARVQRWLSIAAGPI--AFGPAIARLITVFGA 121 Query: 128 LTWAQNAITCGFNALEQILQS-TAGIYCVGDEVTMADLCLVPQVANAERFKVDLTPYPTI 186 A IT N L+ I Q + Y GDE T+AD+ +A+A V L Y + Sbjct: 122 PNNADEVITRSHNLLKVIDQELSKSTYLAGDEPTIADVAAYSYIAHAPEGNVSLADYANV 181 Query: 187 SSINKRLLVLEAF 199 + R+ L F Sbjct: 182 RAWLARIEALPGF 194 Lambda K H 0.321 0.136 0.400 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 71 Number of extensions: 2 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 216 Length of database: 207 Length adjustment: 21 Effective length of query: 195 Effective length of database: 186 Effective search space: 36270 Effective search space used: 36270 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.9 bits) S2: 45 (21.9 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory