Align Glycine betaine/proline betaine transport system permease protein ProW (characterized)
to candidate AO353_05425 AO353_05425 glycine/betaine ABC transporter permease
Query= SwissProt::P14176 (354 letters) >FitnessBrowser__pseudo3_N2E3:AO353_05425 Length = 238 Score = 101 bits (251), Expect = 2e-26 Identities = 66/216 (30%), Positives = 105/216 (48%), Gaps = 7/216 (3%) Query: 127 VATLVSLIAIGAIGAWSQAMVT-----LALVLTALLFCIVIGLPLGIWLARSPRAAKIIR 181 +A L+ I I I + ++ L LVL ++L +V+G+P GI L+R + R Sbjct: 19 LALLIHWIGINTIDLYRDDLLFYLQAHLILVLVSMLAALVVGIPAGILLSRPTMVGRAER 78 Query: 182 --PLLDAMQTTPAFVYLVPIVMLFGIGNVPGVVVTIIFALPPIIRLTILGINQVPADLIE 239 L + T P L + + GIG+ P + + +L PI+R T G+ V L E Sbjct: 79 FMQLFNIGNTVPPLAVLAIALGILGIGSGPAIFALFLASLLPIVRNTYEGLKNVQGSLKE 138 Query: 240 ASRSFGASPRQMLFKVQLPLAMPTIMAGVNQTLMLALSMVVIASMIAVGGLGQMVLRGIG 299 A+ G +PRQ+L++V+LP AMP I+ GV L + + +A +I LG ++ GI Sbjct: 139 AAIGIGMTPRQVLWRVELPNAMPIIIGGVRVALAINVGTAPLAFLIGANSLGSLIFPGIA 198 Query: 300 RLDMGLATVGGVGIVILAIILDRLTQAVGRDSRSRG 335 + +G +LA++LD L R RG Sbjct: 199 LNNQPQLILGAACTALLALLLDGLVTLASRLWLERG 234 Lambda K H 0.326 0.141 0.435 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 230 Number of extensions: 16 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 354 Length of database: 238 Length adjustment: 26 Effective length of query: 328 Effective length of database: 212 Effective search space: 69536 Effective search space used: 69536 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.0 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.6 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory