GapMind for catabolism of small carbon sources

 

Aligments for a candidate for prpE in Pseudomonas fluorescens FW300-N2E3

Align Acetyl-coenzyme A synthetase; AcCoA synthetase; Acs; Acetate--CoA ligase; Acyl-activating enzyme; EC 6.2.1.1 (characterized)
to candidate AO353_19945 AO353_19945 acetyl-CoA synthetase

Query= SwissProt::P27550
         (652 letters)



>lcl|FitnessBrowser__pseudo3_N2E3:AO353_19945 AO353_19945 acetyl-CoA
           synthetase
          Length = 588

 Score =  337 bits (863), Expect = 1e-96
 Identities = 215/593 (36%), Positives = 308/593 (51%), Gaps = 28/593 (4%)

Query: 47  DWIKPYQKVKNTSFAPGNVSIKWYEDGTLNLAANCLDRHLQENGDRTAIIWEGDDASQSK 106
           +W+   Q  +  S+     ++     G LNLA   +DRH +    R   +   D      
Sbjct: 19  NWLDSVQAREGFSWQGEASALAGLPGGGLNLAYEAVDRHAEGKHRRHTALRILDRNGGRC 78

Query: 107 HISYKELHRDVCRFANTLLELGIKKGDVVAIYMPMVPEAAVAMLACARIGAVHSVIFGGF 166
            ISY  L     RFAN L  LG+  G+ + +      E  + +L   ++G V S +F  F
Sbjct: 79  DISYARLSLLSNRFANVLKTLGVVPGERLFVLCGRGLELYLGVLGGLKLGCVVSPLFCAF 138

Query: 167 SPEAVAGRIIDSNSRLVITSDEGVRAGRSIPLKKNVDDALKNPNVTSVEHVVVLKRTGGK 226
            PE +  R+      +++TS+          L ++   A++   + +++HV++    GG 
Sbjct: 139 GPEPIETRLRLGEGSVLLTSET---------LYRHKVAAIRE-RLPALKHVLLYDEEGGN 188

Query: 227 IDWQEGRDLWWHDLVEQASDQHQAEEMNAEDPLFILYTSGSTGKPKGVLHTTGGYLVYAA 286
               EG  L  H L+  A+D  +     A+ P  + +TSG+TG PKGVLH  G  L +  
Sbjct: 189 TTPVEGT-LSLHRLLANATDHFEIAHTTADSPALLHFTSGTTGTPKGVLHVHGAVLTHR- 246

Query: 287 LTFKYVFDYHPGDIYWCTADVGWVTGHSYLLYGPLACGATTLMFEGVPNWPTPARMAQVV 346
           +T KY  D HP DIYWC+AD GWVTG SY +  PL  G T+++ EG        R  + +
Sbjct: 247 VTGKYALDLHPDDIYWCSADPGWVTGTSYGIIAPLLLGVTSVV-EGREF--DAERWYRTL 303

Query: 347 DKHQVNILYTAPTAIRALMAEGDKAIEGTDRSSLRILGSVGEPINPEAWEWYWKKIGNEK 406
           +K QV + YTAPTAIR LM  G +         LR + SVGEP+NPEA  W  + +G   
Sbjct: 304 EKQQVTVWYTAPTAIRLLMKAGAELAHSHRFPCLRFIASVGEPLNPEAVWWGQEVLG--- 360

Query: 407 CPVVDTWWQTETGGFMITPLPGATELKAGSATRPFFGVQPALV----DNEGNPLEGATEG 462
            P+ D WWQTETGG MI      T +K GS  +P  GV+ A+V      E + L     G
Sbjct: 361 LPIHDNWWQTETGGIMIANTVAMT-IKPGSMGKPLPGVEAAVVVRGAAGELDYLGDNEVG 419

Query: 463 SLVITDSWPGQARTLFGDHERFEQTYFSTFKNMYFSGDGARRDEDGYYWITGRVDDVLNV 522
            L +   WP   RT  G  ER+ Q + + +   Y SGD  RRD DGYYW  GR DDV+  
Sbjct: 420 ELALKQPWPAMFRTYLGQEERYRQCFVAGW---YLSGDLVRRDADGYYWFIGRSDDVIKS 476

Query: 523 SGHRLGTAEIESALVAHPKIAEAAVVGIPHNIKGQAIYAYVTLNHGEEPSPELYAEVRNW 582
           +GH +G  E+ES+L+ HP +AEAAV+G P  + G+ +  +V+L  G   S  L+ E+   
Sbjct: 477 AGHLIGPFEVESSLMEHPAVAEAAVIGKPDPLLGETVKVFVSLKSGFTASQALHDELLGH 536

Query: 583 VRKEIGPLATPDVLHWTDSLPKTRSGKIMRRILRKIAAGDTSNLGDTSTLADP 635
            RK +G +  P  L + ++LP TRSGK+MRR+L+    G     GDTS+L +P
Sbjct: 537 GRKRLGAVVAPKELEFVEALPHTRSGKLMRRLLKARELGLPE--GDTSSLENP 587


Lambda     K      H
   0.317    0.135    0.421 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 1
Number of Hits to DB: 1113
Number of extensions: 63
Number of successful extensions: 8
Number of sequences better than 1.0e-02: 1
Number of HSP's gapped: 1
Number of HSP's successfully gapped: 1
Length of query: 652
Length of database: 588
Length adjustment: 37
Effective length of query: 615
Effective length of database: 551
Effective search space:   338865
Effective search space used:   338865
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 53 (25.0 bits)

This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.

Links

Downloads

Related tools

About GapMind

Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.

A candidate for a step is "high confidence" if either:

where "other" refers to the best ublast hit to a sequence that is not annotated as performing this step (and is not "ignored").

Otherwise, a candidate is "medium confidence" if either:

Other blast hits with at least 50% coverage are "low confidence."

Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:

GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).

For more information, see the paper from 2019 on GapMind for amino acid biosynthesis, the paper from 2022 on GapMind for carbon sources, or view the source code.

If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know

by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory