GapMind for catabolism of small carbon sources

 

Aligments for a candidate for gabT in Pseudomonas fluorescens FW300-N2E3

Align Gamma-aminobutyrate:alpha-ketoglutarate aminotransferase (EC 2.6.1.19) (characterized)
to candidate AO353_06085 AO353_06085 omega amino acid--pyruvate aminotransferase

Query= reanno::SB2B:6938540
         (460 letters)



>lcl|FitnessBrowser__pseudo3_N2E3:AO353_06085 AO353_06085 omega
           amino acid--pyruvate aminotransferase
          Length = 449

 Score =  273 bits (698), Expect = 8e-78
 Identities = 166/457 (36%), Positives = 245/457 (53%), Gaps = 19/457 (4%)

Query: 1   MQQQQQDTISALQAMDAAHHLHPFTDSADLAKRGTRVIERAEGVYIWDAKGNKLLDAMAG 60
           M   +   +S    +    H  P+T + +  +R  R+I  AEG Y+ D KG K+ D+++G
Sbjct: 1   MNVPENAPVSLASQLKLDAHWMPYTANRNF-QRDPRLIVAAEGSYLIDDKGRKVYDSLSG 59

Query: 61  LWCVNVGYGRKSIADAAYAQLQTLPFYNNFFQCTHEPAIRLASKIASLAPGHMNRVFFTG 120
           LW    G+ RK I +A   QL TL  Y+  FQ  H  + +LA KI  L PG++N VFFT 
Sbjct: 60  LWTCGAGHTRKEIQEAVAKQLGTLD-YSPGFQYGHPLSFQLAEKITELTPGNLNHVFFTD 118

Query: 121 SGSEANDTNLRMVRRYWDLKGMPSKKTIISRKNAYHGSTVAGASLGGMGFMHQQGDLPIP 180
           SGSE  DT ++MVR YW LKG  +K  +I R   YHG  +AG SLGG+    +     + 
Sbjct: 119 SGSECADTAVKMVRAYWRLKGQSTKTKMIGRARGYHGVNIAGTSLGGVNGNRKLFGQAMM 178

Query: 181 GIVHIDQPYWFGEGRDMS-PEAFGIKTAQALEAKILELGE-DKVAAFIAEPFQGAGGVII 238
            + H+              P+  GI  A+ L  K++EL +   +AA   EP  G+ GV++
Sbjct: 179 DVDHLPHTLLASNAYSRGMPKEGGIVLAEEL-LKLIELHDASNIAAVFVEPLAGSAGVLV 237

Query: 239 PPDSYWNEIKRILEKYNILFILDEVISGFGRTGNWFAAQTLGLKPDLITIAKGMTSGYIP 298
           PP  Y   ++ I +++NIL + DEVI+GFGRTG+ F A + G+ PDL+ IAK +T+G IP
Sbjct: 238 PPQGYLKRLREICDQHNILLVFDEVITGFGRTGSMFGADSFGVTPDLMCIAKQVTNGAIP 297

Query: 299 MGGVIVSDRVADVLISDGG-----EFAHGFTYSGHPVAAAVALENIRILEEERLVDKVRT 353
           MG VI S  +    ++        EF HG+TYS HPVA A  L  + +L++E LV  V  
Sbjct: 298 MGAVIASSEIYQTFMNQATPEYAVEFPHGYTYSAHPVACAAGLAALDLLQKENLVQSV-A 356

Query: 354 DTGPYLQDRLQTLSAHPLVGEVRGMGMVGAIELVA-DKHSMVRFGSEISAGMLCREACIE 412
           +  P+ ++ L  L     V ++R  G+ GAI++ A D  ++VR      AGM    A  +
Sbjct: 357 EVAPHFENALHGLKGSKNVIDIRNYGLAGAIQIAARDGDAIVR---PFEAGM----ALWK 409

Query: 413 SGLVMRAVGDTMIISPPLCITRDEIDELIFKASQALS 449
           +G  +R  GDT+   P       ++D L     + L+
Sbjct: 410 AGFYVRFGGDTLQFGPTFNSKPQDLDRLFDAVGEVLN 446


Lambda     K      H
   0.321    0.137    0.408 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 1
Number of Hits to DB: 482
Number of extensions: 14
Number of successful extensions: 4
Number of sequences better than 1.0e-02: 1
Number of HSP's gapped: 1
Number of HSP's successfully gapped: 1
Length of query: 460
Length of database: 449
Length adjustment: 33
Effective length of query: 427
Effective length of database: 416
Effective search space:   177632
Effective search space used:   177632
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.8 bits)
S2: 51 (24.3 bits)

This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.

Links

Downloads

Related tools

About GapMind

Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.

A candidate for a step is "high confidence" if either:

where "other" refers to the best ublast hit to a sequence that is not annotated as performing this step (and is not "ignored").

Otherwise, a candidate is "medium confidence" if either:

Other blast hits with at least 50% coverage are "low confidence."

Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:

GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).

For more information, see the paper from 2019 on GapMind for amino acid biosynthesis, the preprint on GapMind for carbon sources, or view the source code.

If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know

by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory