GapMind for catabolism of small carbon sources

 

Aligments for a candidate for btsT in Pseudomonas fluorescens FW300-N2E3

Align Pyruvate/proton symporter BtsT; Brenztraubensaure transporter; Pyruvate/H(+) symporter (characterized)
to candidate AO353_25255 AO353_25255 carbon starvation protein A

Query= SwissProt::P39396
         (716 letters)



>lcl|FitnessBrowser__pseudo3_N2E3:AO353_25255 AO353_25255 carbon
           starvation protein A
          Length = 685

 Score =  979 bits (2531), Expect = 0.0
 Identities = 483/705 (68%), Positives = 582/705 (82%), Gaps = 25/705 (3%)

Query: 5   KIFKHIPWVILGIIGAFCLAVVALRRGEHISALWIVVASVSVYLVAYRYYSLYIAQKVMK 64
           ++ KH+ W  + ++GAF L+VVALRRGE I+ALWIVVA+V++YLVAYRYYSL+IA KVM+
Sbjct: 3   RLAKHLAWFAVAVLGAFALSVVALRRGEAINALWIVVAAVAIYLVAYRYYSLFIANKVMQ 62

Query: 65  LDPTRATPAVINNDGLNYVPTNRYVLFGHHFAAIAGAGPLVGPVLAAQMGYLPGTLWLLA 124
           LDP RATPAV+NNDGL+YVPTN+++LFGHHFAAIAGAGPLVGPVLAAQMGYLPGTLWL+A
Sbjct: 63  LDPGRATPAVVNNDGLDYVPTNKHILFGHHFAAIAGAGPLVGPVLAAQMGYLPGTLWLIA 122

Query: 125 GVVLAGAVQDFMVLFISSRRNGASLGEMIKEEMGPVPGTIALFGCFLIMIIILAVLALIV 184
           GVVLAGAVQDFMVLF+S+RRNG SLG+M++EEMG VPGTIALFGCFLIMIIILAVLALIV
Sbjct: 123 GVVLAGAVQDFMVLFMSTRRNGRSLGDMVREEMGRVPGTIALFGCFLIMIIILAVLALIV 182

Query: 185 VKALAESPWGVFTVCSTVPIALFMGIYMRFIRPGRVGEVSVIGIVLLVASIYFGGVIAHD 244
           VKALA+SPWG+FTV +T+PIA+FMG+YMR+IRPGR+GE+SV+G++LL+ SI+ GG IA D
Sbjct: 183 VKALADSPWGMFTVMATIPIAMFMGVYMRYIRPGRIGEISVVGVLLLLGSIWLGGQIAAD 242

Query: 245 PYWGPALTFKDTTITFALIGYAFVSALLPVWLILAPRDYLATFLKIGVIVGLALGIVVLN 304
           P W  A +F    IT+ LIGY FV+A++PVWLILAPRDYL+TFLKIG I+ LA+GI++  
Sbjct: 243 PVWAKAFSFTGIQITWMLIGYGFVAAVMPVWLILAPRDYLSTFLKIGTIMALAIGILITM 302

Query: 305 PELKMPAMTQYIDGTGPLWKGALFPFLFITIACGAVSGFHALISSGTTPKLLANETDARF 364
           PELKMPA+TQ+IDGTGP+WKG LFPFLFITIACGAVSGFHALI+SGTTPKLLA+E  AR+
Sbjct: 303 PELKMPALTQFIDGTGPVWKGGLFPFLFITIACGAVSGFHALIASGTTPKLLASEGHARY 362

Query: 365 IGYGAMLMESFVAIMALVAASIIEPGLYFAMNTPPAGLGITMPNLHEMGGENAPIIMAQL 424
           IGYG MLMESFVAIMA+VAAS+IEPG+YFAMN+P A           +GG+         
Sbjct: 363 IGYGGMLMESFVAIMAMVAASVIEPGVYFAMNSPAA----------IVGGD--------- 403

Query: 425 KDVTAHAAATVSSWGFVISPEQILQTAKDIGEPSVLNRAGGAPTLAVGIAHVFHKVLPMA 484
                  A TVSSWGF+I+PE +   AKDIGE +VL RAGGAPTLAVGIA + H VLP  
Sbjct: 404 ---VVQVAQTVSSWGFMITPEALQAVAKDIGETTVLARAGGAPTLAVGIAQILHSVLPGE 460

Query: 485 D-MGFWYHFGILFEALFILTALDAGTRSGRFMLQDLLGNFIPFLKKTDSLVAGIIGTAGC 543
           + M FWYHF ILFEALFILTA+DAGTR+GRFMLQDLLG+F+P LK+T+S  A +I TAGC
Sbjct: 461 NTMAFWYHFAILFEALFILTAVDAGTRAGRFMLQDLLGSFVPALKRTESWTANLIATAGC 520

Query: 544 VGLWGYLLYQGVVDPLGGVKSLWPLFGISNQMLAAVALVLGTVVLIKMKRTQYIWVTVVP 603
           V +WGYLLYQGV+DPLGG+ +LWPLFGISNQMLA +AL+L TVVLIKMKR +YIWVT++P
Sbjct: 521 VAMWGYLLYQGVIDPLGGINTLWPLFGISNQMLAGIALMLSTVVLIKMKRQRYIWVTLLP 580

Query: 604 AVWLLICTTWALGLKLFSTNPQMEGFFYMASQYKEKIANGTDLT-AQQIANMNHIVVNNY 662
           A WLLICTT A  +KLF  NP + GF  +A +Y + +ANG  L  A+ I  M H++ N Y
Sbjct: 581 AAWLLICTTTAGFIKLFDANPAI-GFLSLAKKYSDALANGQILAPAKDITQMQHVIYNAY 639

Query: 663 TNAGLSILFLIVVYSIIFYGFKTWLAVRNSDKRTDKETPYVPIPE 707
           TNA L+ LFL VV+SI+FY  K  ++   S +RTDKE+P+  IPE
Sbjct: 640 TNATLTALFLFVVFSILFYAIKVGISAWGSKERTDKESPFQAIPE 684


Lambda     K      H
   0.327    0.142    0.440 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 1
Number of Hits to DB: 1517
Number of extensions: 69
Number of successful extensions: 7
Number of sequences better than 1.0e-02: 1
Number of HSP's gapped: 1
Number of HSP's successfully gapped: 1
Length of query: 716
Length of database: 685
Length adjustment: 39
Effective length of query: 677
Effective length of database: 646
Effective search space:   437342
Effective search space used:   437342
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 15 ( 7.1 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 40 (21.7 bits)
S2: 54 (25.4 bits)

This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.

Links

Downloads

Related tools

About GapMind

Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.

A candidate for a step is "high confidence" if either:

where "other" refers to the best ublast hit to a sequence that is not annotated as performing this step (and is not "ignored").

Otherwise, a candidate is "medium confidence" if either:

Other blast hits with at least 50% coverage are "low confidence."

Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:

GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).

For more information, see the paper from 2019 on GapMind for amino acid biosynthesis, the paper from 2022 on GapMind for carbon sources, or view the source code.

If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know

by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory