Align NAD(P)+-dependent L-rhamnose 1-dehydrogenase (EC 1.1.1.378; EC 1.1.1.173) (characterized)
to candidate AO353_24520 AO353_24520 short-chain dehydrogenase
Query= metacyc::MONOMER-16230 (256 letters) >FitnessBrowser__pseudo3_N2E3:AO353_24520 Length = 249 Score = 163 bits (413), Expect = 3e-45 Identities = 105/258 (40%), Positives = 147/258 (56%), Gaps = 13/258 (5%) Query: 1 MLLIDKTVIVTGAS--RGIGRAAARECARQGARVVIGHSGSDEGRAGALSLAEEIAAFGG 58 MLL K I+TGA+ RGIGRA A A+QGARVVI R A SL E Sbjct: 1 MLLQGKVAIITGAASARGIGRATATTFAQQGARVVILDLDESAARDAAASLGEG------ 54 Query: 59 TAIAVGADAADLDSGEKLVAAAVEAFGSVDVLVNNAGICPFHSFLDMPRELYLKTVGTNL 118 + +GA+ AD + VA +E FG +D+L+NNAGI LD+ Y K + +L Sbjct: 55 -HLGIGANVADELQVRQAVAKIIEHFGRIDILINNAGITQPLKTLDIRPSDYDKVLDVSL 113 Query: 119 NGAYFTVQAAARRMKEQGRGGAIIAVSSISALVGGAM--QTHYTPTKAGLLSLMQSCAIA 176 G QA M++Q G+I+ +SS+SA GG + HY+ KAG+L L ++ A Sbjct: 114 RGTLLMSQAVIPTMRQQS-SGSIVCMSSVSAQRGGGIFGGPHYSAAKAGVLGLAKAMARE 172 Query: 177 LGPYGIRCNAVLPGTIATDINKEDLSDLEKRERMTSRVPLGRLGEPDDLAGPIVFLASDM 236 LGP +R N++ PG I TDI + D E+R + +PLGRLGE D+A +FLASD+ Sbjct: 173 LGPDKVRVNSIAPGLIHTDITGGLMQD-ERRHAIIDGIPLGRLGEAQDVANAALFLASDL 231 Query: 237 ARYVTGASLLVDGGLFVN 254 + Y+TG +L V+GG+ ++ Sbjct: 232 SSYLTGITLDVNGGMLIH 249 Lambda K H 0.319 0.136 0.383 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 184 Number of extensions: 12 Number of successful extensions: 5 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 256 Length of database: 249 Length adjustment: 24 Effective length of query: 232 Effective length of database: 225 Effective search space: 52200 Effective search space used: 52200 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 46 (22.3 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory