GapMind for catabolism of small carbon sources

 

Aligments for a candidate for sdaC in Pseudomonas fluorescens FW300-N2E3

Align Serine transporter (characterized)
to candidate AO353_21595 AO353_21595 serine/threonine protein kinase

Query= SwissProt::P0AAD6
         (429 letters)



>lcl|FitnessBrowser__pseudo3_N2E3:AO353_21595 AO353_21595
           serine/threonine protein kinase
          Length = 426

 Score =  553 bits (1424), Expect = e-162
 Identities = 283/419 (67%), Positives = 342/419 (81%), Gaps = 10/419 (2%)

Query: 10  ASKDSRSAWRKTDTMWMLGLYGTAIGAGVLFLPINAGVGGMIPLIIMAILAFPMTFFAHR 69
           A+  S S+W + DT WMLGL+GTAIGAG LFLPINAG+GG  PL+I+A+LAFPMTF+AHR
Sbjct: 15  AAPASLSSWNRHDTTWMLGLFGTAIGAGTLFLPINAGLGGFWPLLILALLAFPMTFYAHR 74

Query: 70  GLTRFVLSGKNPGEDITEVVEEHFGIGAGKLITLLYFFAIYPILLVYSVAITNTVESFMS 129
           GLTRFVLSG+  G DITEVVEEHFGI AG LITLLYFFAI+PILL+YSVA+TNTV SF+ 
Sbjct: 75  GLTRFVLSGR-AGADITEVVEEHFGIKAGALITLLYFFAIFPILLIYSVALTNTVGSFLE 133

Query: 130 HQLGMTPPPRAILSLILIVGMMTIVRFGEQMIVKAMSILVFPFVGVLMLLALYLIPQWNG 189
           HQL + PPPRAILS +LI+G++ +VR GEQMIVKAMS++V+PF+  L+ LA++LIP WNG
Sbjct: 134 HQLHIMPPPRAILSFVLILGLLAVVRCGEQMIVKAMSLMVYPFIVALLFLAVFLIPHWNG 193

Query: 190 AALETLS-LDTASATGNGLWMTLWLAIPVMVFSFNHSPIISSFAVAKREEYGDMAEQKCS 248
             LET S L   SA    L  TLWLAIPVMVFSFNHSPIIS+FAV ++  YG  AE++ S
Sbjct: 194 GILETASTLPEPSA----LLHTLWLAIPVMVFSFNHSPIISAFAVDQKRRYGAHAEERSS 249

Query: 249 KILAFAHIMMVLTVMFFVFSCVLSLTPADLAAAKEQNISILSYLANHFNAPVIAWMAPII 308
           +IL+ AH +MV+ V+FFVFSCVL+L+PA LA AK QN+SILSYLANHF+ P IA+ AP+I
Sbjct: 250 QILSRAHTLMVVMVLFFVFSCVLTLSPAQLAEAKAQNLSILSYLANHFSNPTIAFAAPLI 309

Query: 309 AIIAITKSFLGHYLGAREGFNGMVIKSLRGKGKSIEINKLNRITALFMLVTTWIVATLNP 368
           A +AI+KSFLGHY+GA EG  G+++KS    G+      L+R+TA FMLV  WIVATLNP
Sbjct: 310 AFVAISKSFLGHYIGASEGLKGLIVKS----GRRPAPKTLDRMTAAFMLVVCWIVATLNP 365

Query: 369 SILGMIETLGGPIIAMILFLMPMYAIQKVPAMRKYSGHISNVFVVVMGLIAISAIFYSL 427
           SILGMIETLGGP+IA ILFLMPMYAI+KVPAM +Y G  SNVFV ++GL+AISA+ YSL
Sbjct: 366 SILGMIETLGGPVIAAILFLMPMYAIRKVPAMARYRGQASNVFVTLVGLVAISALIYSL 424


Lambda     K      H
   0.328    0.140    0.416 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 1
Number of Hits to DB: 631
Number of extensions: 31
Number of successful extensions: 4
Number of sequences better than 1.0e-02: 1
Number of HSP's gapped: 1
Number of HSP's successfully gapped: 1
Length of query: 429
Length of database: 426
Length adjustment: 32
Effective length of query: 397
Effective length of database: 394
Effective search space:   156418
Effective search space used:   156418
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 15 ( 7.1 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 40 (21.8 bits)
S2: 51 (24.3 bits)

This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.

Links

Downloads

Related tools

About GapMind

Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.

A candidate for a step is "high confidence" if either:

where "other" refers to the best ublast hit to a sequence that is not annotated as performing this step (and is not "ignored").

Otherwise, a candidate is "medium confidence" if either:

Other blast hits with at least 50% coverage are "low confidence."

Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:

GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).

For more information, see the paper from 2019 on GapMind for amino acid biosynthesis, the paper from 2022 on GapMind for carbon sources, or view the source code.

If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know

by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory