Align Sorbitol dehydrogenase; SDH; Galactitol 2-dehydrogenase; L-iditol 2-dehydrogenase; Polyol dehydrogenase; EC 1.1.1.-; EC 1.1.1.16; EC 1.1.1.14 (characterized)
to candidate AO353_24520 AO353_24520 short-chain dehydrogenase
Query= SwissProt::Q59787 (256 letters) >FitnessBrowser__pseudo3_N2E3:AO353_24520 Length = 249 Score = 152 bits (383), Expect = 8e-42 Identities = 91/256 (35%), Positives = 143/256 (55%), Gaps = 15/256 (5%) Query: 1 MRLDGKTALITG--SARGIGRAFAEAYVREGARVAIADINLEAARATAAEIGPAACAIAL 58 M L GK A+ITG SARGIGRA A + ++GARV I D++ AAR AA +G I Sbjct: 1 MLLQGKVAIITGAASARGIGRATATTFAQQGARVVILDLDESAARDAAASLGEGHLGIGA 60 Query: 59 DVTDQASIDRCVAELLDRWGSIDILVNNAALFDLAPIVEITRESYDRLFAINVSGTLFMM 118 +V D+ + + VA++++ +G IDIL+NNA + ++I YD++ +++ GTL M Sbjct: 61 NVADELQVRQAVAKIIEHFGRIDILINNAGITQPLKTLDIRPSDYDKVLDVSLRGTLLMS 120 Query: 119 QAVARAMIAGGRGGKIINMASQAGRRGEALVG--VYCATKAAVISLTQSAGLNLIRHGIN 176 QAV M G I+ M+S + +RG + G Y A KA V+ L ++ L + Sbjct: 121 QAVIPTM-RQQSSGSIVCMSSVSAQRGGGIFGGPHYSAAKAGVLGLAKAMARELGPDKVR 179 Query: 177 VNAIAPGVVDGEHWDGVDAKFADYENLPRGEKKRQVGAAVPFGRMGRAEDLTGMAIFLAT 236 VN+IAPG++ + G L + E++ + +P GR+G A+D+ A+FLA+ Sbjct: 180 VNSIAPGLIHTDITGG----------LMQDERRHAIIDGIPLGRLGEAQDVANAALFLAS 229 Query: 237 PEADYIVAQTYNVDGG 252 + Y+ T +V+GG Sbjct: 230 DLSSYLTGITLDVNGG 245 Lambda K H 0.321 0.135 0.392 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 164 Number of extensions: 12 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 256 Length of database: 249 Length adjustment: 24 Effective length of query: 232 Effective length of database: 225 Effective search space: 52200 Effective search space used: 52200 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.9 bits) S2: 46 (22.3 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory