Align UTP-glucose-1-phosphate uridylyltransferase (EC 2.7.7.9) (characterized)
to candidate AO353_26975 AO353_26975 UTP--glucose-1-phosphate uridylyltransferase
Query= BRENDA::O25363 (273 letters) >lcl|FitnessBrowser__pseudo3_N2E3:AO353_26975 AO353_26975 UTP--glucose-1-phosphate uridylyltransferase Length = 279 Score = 368 bits (944), Expect = e-107 Identities = 174/266 (65%), Positives = 220/266 (82%) Query: 1 MIKKCLFPAAGYGTRFLPITKTIPKEMLPIVDKPLIQYAVEEAMEAGCEVMAIVTGRNKR 60 MIKKCLFPAAGYGTRFLP TK +PKEMLP+V+KPLIQY VEEA++AG ++IVTGR KR Sbjct: 1 MIKKCLFPAAGYGTRFLPATKAMPKEMLPVVNKPLIQYGVEEALDAGLTEISIVTGRGKR 60 Query: 61 SLEDYFDTSYEIEHQIQGTNKENALKSIRNIIEKCCFSYVRQKQMKGLGHAILTGEALIG 120 +LED+FD SYE+E+QI+GT+KE L IR ++++C FSY RQ +MKGLGHAILTG LIG Sbjct: 61 ALEDHFDISYELENQIKGTDKEKYLVGIRKLLDECSFSYTRQTEMKGLGHAILTGRPLIG 120 Query: 121 NEPFAVILADDLCISHDHPSVLKQMTSLYQKYQCSIVAIEEVALEEVSKYGVIRGEWLEE 180 +EPFAV+LADDLC++ D VL QM LY++Y+C+IVAI+EV +E +KYGVI G+ + + Sbjct: 121 DEPFAVVLADDLCVNLDGDGVLTQMVKLYKQYRCTIVAIQEVDPQETNKYGVIAGDLIGD 180 Query: 181 GVYEIKDMVEKPNQEDAPSNLAVIGRYILTPDIFEILSETKPGKNNEIQITDALRTQAKR 240 +Y +++MVEKP EDAPSNLA+IGRYILTPDIF+++ ET+PGK EIQITDAL QA+ Sbjct: 181 DLYRVRNMVEKPKPEDAPSNLAIIGRYILTPDIFKLIEETEPGKGGEIQITDALMKQAQD 240 Query: 241 KRIIAYQFKGKRYDCGSVEGYIEASN 266 +IAY+FKG R+DCG EGYIEA+N Sbjct: 241 GCVIAYKFKGTRFDCGGAEGYIEATN 266 Lambda K H 0.318 0.136 0.391 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 306 Number of extensions: 10 Number of successful extensions: 1 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 273 Length of database: 279 Length adjustment: 25 Effective length of query: 248 Effective length of database: 254 Effective search space: 62992 Effective search space used: 62992 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 47 (22.7 bits)
Align candidate AO353_26975 AO353_26975 (UTP--glucose-1-phosphate uridylyltransferase)
to HMM TIGR01099 (galU: UTP--glucose-1-phosphate uridylyltransferase (EC 2.7.7.9))
# hmmsearch :: search profile(s) against a sequence database # HMMER 3.3.1 (Jul 2020); http://hmmer.org/ # Copyright (C) 2020 Howard Hughes Medical Institute. # Freely distributed under the BSD open source license. # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query HMM file: ../tmp/path.carbon/TIGR01099.hmm # target sequence database: /tmp/gapView.15170.genome.faa # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: TIGR01099 [M=261] Accession: TIGR01099 Description: galU: UTP--glucose-1-phosphate uridylyltransferase Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 1.1e-123 398.0 0.0 1.2e-123 397.8 0.0 1.0 1 lcl|FitnessBrowser__pseudo3_N2E3:AO353_26975 AO353_26975 UTP--glucose-1-phosp Domain annotation for each sequence (and alignments): >> lcl|FitnessBrowser__pseudo3_N2E3:AO353_26975 AO353_26975 UTP--glucose-1-phosphate uridylyltransferase # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 397.8 0.0 1.2e-123 1.2e-123 1 261 [] 2 264 .. 2 264 .. 0.99 Alignments for each domain: == domain 1 score: 397.8 bits; conditional E-value: 1.2e-123 TIGR01099 1 irkaviPaaGlGtrlLPatkaiPkemlpivdkPliqyvveeaveaGieeivlvtgrskraiedhf 65 i+k+++PaaG+Gtr+LPatka+Pkemlp+v+kPliqy veea++aG++ei +vtgr+kra+edhf lcl|FitnessBrowser__pseudo3_N2E3:AO353_26975 2 IKKCLFPAAGYGTRFLPATKAMPKEMLPVVNKPLIQYGVEEALDAGLTEISIVTGRGKRALEDHF 66 89*************************************************************** PP TIGR01099 66 DtsyeleaklekknkeellkevrkiaelatilyvrqkeakGLGhavllaeelvgdepfavllgDd 130 D+syele++++ ++ke++l +rk+ +++++ y+rq e+kGLGha+l++++l+gdepfav+l+Dd lcl|FitnessBrowser__pseudo3_N2E3:AO353_26975 67 DISYELENQIKGTDKEKYLVGIRKLLDECSFSYTRQTEMKGLGHAILTGRPLIGDEPFAVVLADD 131 ***************************************************************** PP TIGR01099 131 lvseeee..alkqlielyektgasiiaveevpkeevskYGvidgeeveeelyevkdlvekPkpee 193 l+++ + +l q+++ly++++++i+a++ev+ +e++kYGvi+g+ + ++ly+v+++vekPkpe+ lcl|FitnessBrowser__pseudo3_N2E3:AO353_26975 132 LCVNLDGdgVLTQMVKLYKQYRCTIVAIQEVDPQETNKYGVIAGDLIGDDLYRVRNMVEKPKPED 196 ***988777******************************************************** PP TIGR01099 194 apsnlaivGrYvltpeifelleetkaGkggeiqltDalrlllekeevlavklkgkryDvGdklgy 258 apsnlai+GrY+ltp+if+l+eet++Gkggeiq+tDal +++++ +v+a+k+kg+r+D+G ++gy lcl|FitnessBrowser__pseudo3_N2E3:AO353_26975 197 APSNLAIIGRYILTPDIFKLIEETEPGKGGEIQITDALMKQAQDGCVIAYKFKGTRFDCGGAEGY 261 ***************************************************************** PP TIGR01099 259 lka 261 ++a lcl|FitnessBrowser__pseudo3_N2E3:AO353_26975 262 IEA 264 *97 PP Internal pipeline statistics summary: ------------------------------------- Query model(s): 1 (261 nodes) Target sequences: 1 (279 residues searched) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.01u 0.01s 00:00:00.02 Elapsed: 00:00:00.01 # Mc/sec: 6.32 // [ok]
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see the paper from 2019 on GapMind for amino acid biosynthesis, the paper from 2022 on GapMind for carbon sources, or view the source code.
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory