Align fructokinase; EC 2.7.1.4 (characterized)
to candidate AO353_26875 AO353_26875 2-dehydro-3-deoxygluconokinase
Query= CharProtDB::CH_006622 (307 letters) >FitnessBrowser__pseudo3_N2E3:AO353_26875 Length = 326 Score = 110 bits (274), Expect = 6e-29 Identities = 83/279 (29%), Positives = 131/279 (46%), Gaps = 11/279 (3%) Query: 29 GAPANVAVGVARLGGNSGFIGAVGGDPFGRYMRHTLQQEQVDVSHMYLDDQHRTSTVVVD 88 GA +NVA+G++RLG ++ VG D GR++ TL+QE +D + D H T + Sbjct: 36 GADSNVAIGLSRLGFKVSWLSRVGADSLGRFVVDTLEQEGLDCRFVETDHAHPTGFQLKS 95 Query: 89 LDDQGERTFT--FMVRPSADLFLVEEDLPQFAAGQWLHVCSIALS-AEPSRSTTFAAMES 145 D G F +A L V+ +P+ + LH I + +E +R +F M Sbjct: 96 RADDGSDPHVEYFRRGSAASLLSVQSIVPEQLEARHLHATGIVPALSESARQMSFELMTR 155 Query: 146 IRSAGGRVSFDPNIRPDLWQDQALLLACLDRALHMANVVKLSEEELVFISSSNDLAYGIA 205 +R AG VSFDPN+RP LW + ++ ++R +A+ V E +S D A IA Sbjct: 156 MRQAGRSVSFDPNLRPTLWGSEQQMIGEINRLAALAHWVLPGLSEGRLLSGFEDPA-DIA 214 Query: 206 SVTERYQPELLLVTRGKAGVLAAFQQKFTHFNARPVAS-VDTTGAGDAFVAGLLASLAAN 264 + E +++ G G Q PV + VDT GAGD F G++++L N Sbjct: 215 AFYLDQGAEAVVIKLGPDGAYYRTQHDQGFVPGVPVTTVVDTVGAGDGFAVGMISALLEN 274 Query: 265 GMPTDMTALEPTLTLAQTCGALATTAKGAMTALPYQRDL 303 ++ + A G+ A ++G M LP + +L Sbjct: 275 ------LSVPDAVQRANWIGSRAVQSRGDMEGLPKRSEL 307 Lambda K H 0.320 0.133 0.392 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 216 Number of extensions: 12 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 307 Length of database: 326 Length adjustment: 27 Effective length of query: 280 Effective length of database: 299 Effective search space: 83720 Effective search space used: 83720 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory