Align Sugar ABC transporter permease (characterized, see rationale)
to candidate AO353_03845 AO353_03845 ABC transporter permease
Query= uniprot:A0A161ZE72 (280 letters) >FitnessBrowser__pseudo3_N2E3:AO353_03845 Length = 282 Score = 94.0 bits (232), Expect = 3e-24 Identities = 74/218 (33%), Positives = 111/218 (50%), Gaps = 7/218 (3%) Query: 18 LIGVLLLYAVFPFYYAIVTSLKPSSALF--EVSYWIENPDFSNYAAVLNQASFLRAIGN- 74 L GV+L AV P IV S SS L SY ++ + + V AS + ++G Sbjct: 23 LSGVILFLAVLPILTMIVMSFSGSSNLDFPPSSYSLQWYKAAWHTFVSPDASDVLSLGKA 82 Query: 75 ---SLVVALCVVTLALFLSLTAAYALGRVKFRGRGTVLMMVLGVSMFPQVAVLSGLFEVI 131 SL+V+ + A +++ AAYAL R++FRG+ L ++ +FP V + L V Sbjct: 83 MSTSLMVSFMAMIFATLVAVPAAYALTRLEFRGKAMALQLMSLPLVFPMVVLGLALLLVF 142 Query: 132 RALGLYNTSWALILSYTIFTLPFTVWVLTTFMGQLPHELEEAAIMDGASPWVTLTRVLLP 191 +L T L++++ I LPF V T M + E+EEAA M GASP + V++P Sbjct: 143 DSLPFQMTVSRLVIAHVILALPFVVKNCTAAMLSIGSEVEEAAQMLGASPTRAIVDVVVP 202 Query: 192 LLWPALVTTGLLAFIAAWNEFLFALTFTLTDTQRTVPV 229 L+ ++ LLAFI ++NEF F T TVP+ Sbjct: 203 LMKSGILAGMLLAFIVSFNEFTVTY-FLYTIDVMTVPI 239 Lambda K H 0.329 0.141 0.433 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 189 Number of extensions: 9 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 280 Length of database: 282 Length adjustment: 26 Effective length of query: 254 Effective length of database: 256 Effective search space: 65024 Effective search space used: 65024 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.8 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory