Align D-serine/D-alanine/glycine transporter (characterized, see rationale)
to candidate AO353_24335 AO353_24335 L-asparagine permease
Query= uniprot:A0A0C4YRF7 (472 letters) >FitnessBrowser__pseudo3_N2E3:AO353_24335 Length = 494 Score = 412 bits (1058), Expect = e-119 Identities = 200/440 (45%), Positives = 292/440 (66%), Gaps = 4/440 (0%) Query: 16 EKDLHRGLKDRHIQMIAIGGAIGVGLFLGAGRAIAIAGPGLMLSYAIGGVAIFFIMRALG 75 E + LK RH+QM+A+GGAIG GLFLGAG + IAGP L + Y + G+ FFI+RALG Sbjct: 29 ESGYSKHLKKRHVQMMALGGAIGTGLFLGAGARLQIAGPALAVIYLVCGIFAFFILRALG 88 Query: 76 ELLLYRPVSGSFATYAEEFVGPFAGFATGWSYWFMWVVTGMAEITAVAVYVHYW--FPDV 133 EL+++RP SGSF +Y EF+G A F GW Y+ +W +TG+ +ITA+A+Y+ YW F DV Sbjct: 89 ELVMHRPSSGSFVSYTREFMGERASFVAGWMYFVVWALTGVVDITAIAIYMKYWSVFSDV 148 Query: 134 PQWIPALATLAVLYLVNCVAVAVFGELEFWFALIKVVTIVAMIVIGLAIIFFGVTPLGPT 193 PQW+ AL+ L V+ L+N V V FGE+EFWFA+IKV I +VIG G G Sbjct: 149 PQWVFALSALGVVTLMNMVGVKWFGEMEFWFAVIKVAAISIFLVIGSFFFATGHEVAGHI 208 Query: 194 ASFSNLWTHGGFMPFGTLGVVLTLQIVMFAYQGVELIGVTAGEAQNPEKVLPHATNGVVW 253 + +GG P G L ++ +Q V+FAY +EL+G AGE + KV+P A NGV+W Sbjct: 209 PGLHLITDNGGIFPHGLLPAIIIVQGVIFAYASIELVGTAAGETADARKVIPKAINGVIW 268 Query: 254 RILIFYVGALIIMMALVPWNELKPGVSPFVYVFERIGVPGAAAIVNLVVITAAASSCNSG 313 RI +FYVG++ +++ ++PW VSPFV FE +GVPG +++N+VV+TAA SS NSG Sbjct: 269 RISLFYVGSVFLLVTVLPWTAYSANVSPFVTFFEALGVPGIGSVMNIVVMTAALSSLNSG 328 Query: 314 IFSTGRMLYTLAQFGQAPRAFGRVSSKHVPSIAITFSAALMGIGVLLNYIVPEQVFVWVT 373 +++TGR+L +LA G AP+ F R+SS+ VP + I + + GV+LN+++P Q+F + Sbjct: 329 LYATGRVLRSLAMGGSAPKMFKRMSSQGVPYMGILVTMGINVFGVVLNFLIPAQLFELLL 388 Query: 374 SISLVGSLWTWSIIMIAHLGYRKAIAAGRVKAVAFRMPGAPYANWLVVAFMIAVAVLLSL 433 ++ +G + TW+ I+++ + YR+A+ G V+ V+FRMPGAP+ +WL + F++ V VLL+ Sbjct: 389 NLVSLGIISTWAFIVLSQINYRRAVKRGEVEMVSFRMPGAPFTSWLTLVFLLVVLVLLAF 448 Query: 434 D--PGTRVALYVAPVWFALL 451 D GT L + V AL+ Sbjct: 449 DYPNGTYTVLSIPLVAGALM 468 Lambda K H 0.328 0.142 0.445 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 731 Number of extensions: 42 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 472 Length of database: 494 Length adjustment: 34 Effective length of query: 438 Effective length of database: 460 Effective search space: 201480 Effective search space used: 201480 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.8 bits) S2: 52 (24.6 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory