GapMind for catabolism of small carbon sources

 

Aligments for a candidate for gcvT in Pseudomonas fluorescens FW300-N2E3

Align Aminomethyltransferase (EC 2.1.2.10) (characterized)
to candidate AO353_03510 AO353_03510 glycine cleavage system protein T

Query= reanno::pseudo13_GW456_L13:PfGW456L13_1866
         (374 letters)



>lcl|FitnessBrowser__pseudo3_N2E3:AO353_03510 AO353_03510 glycine
           cleavage system protein T
          Length = 374

 Score =  717 bits (1851), Expect = 0.0
 Identities = 361/374 (96%), Positives = 366/374 (97%)

Query: 1   MSTEQLLKTPLHALHIELGARMVPFAGYDMPVQYPLGVMKEHQHTRDQAGLFDVSHMGQI 60
           MSTEQLLKTPLHALHIELGARMVPFAGYDMPVQYPLGVMKEHQHTRDQAGLFDVSHMGQI
Sbjct: 1   MSTEQLLKTPLHALHIELGARMVPFAGYDMPVQYPLGVMKEHQHTRDQAGLFDVSHMGQI 60

Query: 61  RLTGANAAKALETLVPVDIIDLPVGMQRYAMFTNATGGILDDLMVANLGNDELFLVVNAA 120
           RLTGANAAKALETLVPVDIIDLPVGMQRYAMFTN  GGILDDLMVANLGNDELFLVVNAA
Sbjct: 61  RLTGANAAKALETLVPVDIIDLPVGMQRYAMFTNQNGGILDDLMVANLGNDELFLVVNAA 120

Query: 121 CKDQDLAHLRKHIGDQCTIEPLFEERALLALQGPAAVTVLARLAPEVAKMTFMQFARVKL 180
           CKDQDLAHLR+HIGDQC+IEPLFEERALLALQGPAAVTVLARLAPEVAKMTFMQF RV L
Sbjct: 121 CKDQDLAHLRQHIGDQCSIEPLFEERALLALQGPAAVTVLARLAPEVAKMTFMQFTRVTL 180

Query: 181 LGVDCFVSRSGYTGEDGFEISVPATNAEALARALLAEAEVAAIGLGARDSLRLEAGLCLY 240
           LGVDCFVSRSGYTGEDGFEISVPA +AEALARALLAE EVAAIGLGARDSLRLEAGLCLY
Sbjct: 181 LGVDCFVSRSGYTGEDGFEISVPAADAEALARALLAEPEVAAIGLGARDSLRLEAGLCLY 240

Query: 241 GHDMNTDTTPIEASLLWAISKPRRADGARAGGFPGAETVFAQQQAGVSRKRVGLLPQERT 300
           GHDMNTDTTPIEASLLWAISKPRRADGARAGGFPGAETVFAQQQ GVSRKRVGLLPQERT
Sbjct: 241 GHDMNTDTTPIEASLLWAISKPRRADGARAGGFPGAETVFAQQQNGVSRKRVGLLPQERT 300

Query: 301 PVREGAEIVNEAGDIIGSVCSGGFGPTLGGPLAMGYVDSAYIALDTPVWAIVRGKKVPLL 360
           PVREGAEIVNEAG+IIGSVCSGGFGPTLGGPLAMGY+DSAYIALDT VWAIVRGKKVPLL
Sbjct: 301 PVREGAEIVNEAGEIIGSVCSGGFGPTLGGPLAMGYLDSAYIALDTQVWAIVRGKKVPLL 360

Query: 361 VSKMPFVPQRYYRG 374
           VSKMPFVPQRYYRG
Sbjct: 361 VSKMPFVPQRYYRG 374


Lambda     K      H
   0.321    0.138    0.405 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 1
Number of Hits to DB: 626
Number of extensions: 21
Number of successful extensions: 1
Number of sequences better than 1.0e-02: 1
Number of HSP's gapped: 1
Number of HSP's successfully gapped: 1
Length of query: 374
Length of database: 374
Length adjustment: 30
Effective length of query: 344
Effective length of database: 344
Effective search space:   118336
Effective search space used:   118336
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.8 bits)
S2: 50 (23.9 bits)

Align candidate AO353_03510 AO353_03510 (glycine cleavage system protein T)
to HMM TIGR00528 (gcvT: glycine cleavage system T protein (EC 2.1.2.10))

# hmmsearch :: search profile(s) against a sequence database
# HMMER 3.3.1 (Jul 2020); http://hmmer.org/
# Copyright (C) 2020 Howard Hughes Medical Institute.
# Freely distributed under the BSD open source license.
# - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -
# query HMM file:                  ../tmp/path.carbon/TIGR00528.hmm
# target sequence database:        /tmp/gapView.26979.genome.faa
# - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -

Query:       TIGR00528  [M=362]
Accession:   TIGR00528
Description: gcvT: glycine cleavage system T protein
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence                                     Description
    ------- ------ -----    ------- ------ -----   ---- --  --------                                     -----------
   5.5e-111  356.9   0.0   6.3e-111  356.7   0.0    1.0  1  lcl|FitnessBrowser__pseudo3_N2E3:AO353_03510  AO353_03510 glycine cleavage sys


Domain annotation for each sequence (and alignments):
>> lcl|FitnessBrowser__pseudo3_N2E3:AO353_03510  AO353_03510 glycine cleavage system protein T
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !  356.7   0.0  6.3e-111  6.3e-111       2     361 ..       7     368 ..       6     369 .. 0.96

  Alignments for each domain:
  == domain 1  score: 356.7 bits;  conditional E-value: 6.3e-111
                                     TIGR00528   2 krtpLydlhtelggklvdfaGwelPvqyk.slieeheavrtkaGlfDvshmgkvelsGskslkfL 65 
                                                    +tpL+ lh elg+++v+faG+ +Pvqy  ++++eh+ +r++aGlfDvshmg+++l+G ++ k+L
  lcl|FitnessBrowser__pseudo3_N2E3:AO353_03510   7 LKTPLHALHIELGARMVPFAGYDMPVQYPlGVMKEHQHTRDQAGLFDVSHMGQIRLTGANAAKAL 71 
                                                   79**************************6488********************************* PP

                                     TIGR00528  66 qrllanDvdaLtkGkaqysvllnaqGGvvDDlivykegednrfllvvnaataekDlewlkehlee 130
                                                   + l++ D+  L++G  +y+ + n +GG++DDl+v + g+d ++ lvvnaa++++Dl++l++h+ +
  lcl|FitnessBrowser__pseudo3_N2E3:AO353_03510  72 ETLVPVDIIDLPVGMQRYAMFTNQNGGILDDLMVANLGND-ELFLVVNAACKDQDLAHLRQHIGD 135
                                                   ****************************************.999********************* PP

                                     TIGR00528 131 evtldtlskeisllalqGPkaktiledlldkaveglkefffvqeaelalkkaliartGytGedGf 195
                                                   + +++ l +e +llalqGP a t+l  l   +v ++  + f  +  l++ +++++r+GytGedGf
  lcl|FitnessBrowser__pseudo3_N2E3:AO353_03510 136 QCSIEPLFEERALLALQGPAAVTVLARLAP-EVAKMTFMQFT-RVTLLGVDCFVSRSGYTGEDGF 198
                                                   **************************9976.56677655555.88999***************** PP

                                     TIGR00528 196 eiavanekavelwkklveaygvkPiGLgarDtLrleagmaLyGqeldeeitPleaglgwvvkker 260
                                                   ei+v+  +a  l+++l++++ v  iGLgarD+Lrleag++LyG++++ ++tP+ea+l w+++k r
  lcl|FitnessBrowser__pseudo3_N2E3:AO353_03510 199 EISVPAADAEALARALLAEPEVAAIGLGARDSLRLEAGLCLYGHDMNTDTTPIEASLLWAISKPR 263
                                                   ***************************************************************99 PP

                                     TIGR00528 261 .....kksdfiGravleeqkengtekklvGlemlekgiarnelkvlltngekevGivtsGtlsPt 320
                                                        +   f G +++  q++ng+ +k+vGl   e+   r++ +++  ++ +++G v sG + Pt
  lcl|FitnessBrowser__pseudo3_N2E3:AO353_03510 264 radgaRAGGFPGAETVFAQQQNGVSRKRVGLLPQERTPVREGAEIVN-EAGEIIGSVCSGGFGPT 327
                                                   888877889**************************************.555************** PP

                                     TIGR00528 321 LgknialayvdkelekiGtklevevrnklvkikvvkklfvr 361
                                                   Lg  +a++y+d+ +    t++   vr+k+v++ v k++fv+
  lcl|FitnessBrowser__pseudo3_N2E3:AO353_03510 328 LGGPLAMGYLDSAYIALDTQVWAIVRGKKVPLLVSKMPFVP 368
                                                   ***************************************97 PP



Internal pipeline statistics summary:
-------------------------------------
Query model(s):                            1  (362 nodes)
Target sequences:                          1  (374 residues searched)
Passed MSV filter:                         1  (1); expected 0.0 (0.02)
Passed bias filter:                        1  (1); expected 0.0 (0.02)
Passed Vit filter:                         1  (1); expected 0.0 (0.001)
Passed Fwd filter:                         1  (1); expected 0.0 (1e-05)
Initial search space (Z):                  1  [actual number of targets]
Domain search space  (domZ):               1  [number of targets reported over threshold]
# CPU time: 0.01u 0.00s 00:00:00.01 Elapsed: 00:00:00.01
# Mc/sec: 9.20
//
[ok]

This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.

Links

Downloads

Related tools

About GapMind

Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.

A candidate for a step is "high confidence" if either:

where "other" refers to the best ublast hit to a sequence that is not annotated as performing this step (and is not "ignored").

Otherwise, a candidate is "medium confidence" if either:

Other blast hits with at least 50% coverage are "low confidence."

Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:

GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).

For more information, see the paper from 2019 on GapMind for amino acid biosynthesis, the paper from 2022 on GapMind for carbon sources, or view the source code.

If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know

by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory