GapMind for catabolism of small carbon sources

 

Aligments for a candidate for pta in Pseudomonas fluorescens FW300-N2E3

Align Phosphate acetyltransferase; Phosphotransacetylase; EC 2.3.1.8 (characterized)
to candidate AO353_05065 AO353_05065 phosphate acetyltransferase

Query= SwissProt::Q9I5A5
         (704 letters)



>lcl|FitnessBrowser__pseudo3_N2E3:AO353_05065 AO353_05065 phosphate
           acetyltransferase
          Length = 699

 Score = 1072 bits (2773), Expect = 0.0
 Identities = 552/699 (78%), Positives = 614/699 (87%), Gaps = 8/699 (1%)

Query: 1   MHTFFIAPTGFGVGLTSISLGLLRALERAGLKVGFFKPIAQLHPGDLGPERSSELVARTH 60
           M TFFIAPT FGVGLTSISLGL+R LERAGLKVGFFKPIAQ HPGD GPERS+ELVARTH
Sbjct: 1   MQTFFIAPTDFGVGLTSISLGLVRTLERAGLKVGFFKPIAQPHPGDTGPERSTELVARTH 60

Query: 61  GLDTPKPLPLAQVERMLGDGQLDELLEEIISLYQRAAADKDVVIVEGMVPTRHASYAARV 120
           GL  P+PL LA VERMLGDGQLDELLEEII+LYQ+AA  KDV++VEGMVPTR ASYAARV
Sbjct: 61  GLKPPQPLGLAHVERMLGDGQLDELLEEIITLYQQAAIGKDVLVVEGMVPTRSASYAARV 120

Query: 121 NFHLAKSLDAEVILVSAPENETLTELTDRIEIQAQLFGGPRDPKVLGVILNKVRGEADAA 180
           N HLAKSLDAEVILVSAPENE LTEL+ R+E+QAQLFGGP+DPKVLGVILNKV+      
Sbjct: 121 NLHLAKSLDAEVILVSAPENEVLTELSGRVELQAQLFGGPKDPKVLGVILNKVK------ 174

Query: 181 NAEDGVADFARRLTEHSPLLRD-DFRLIGCIPWQDELNAARTRDIADLLSARVINAGDYE 239
             ++ +  FA RL EHSPLLR  DFRL+GCIP+Q ELNA RTRD+ADL+ A+V+NAGDYE
Sbjct: 175 -TDESMEAFAARLKEHSPLLRSGDFRLLGCIPFQPELNAPRTRDVADLMGAQVLNAGDYE 233

Query: 240 QRRVQKIVLCARAVPNTVQLLKPGVLVVTPGDRDDIILAASLAAMNGVPLAGLLLCSDFP 299
            RR+ KI++CAR + NTV+LLKPGVLVVTPGDRDDIILA SLAA+NGVPLAGLLL S   
Sbjct: 234 TRRMSKIIICARTMRNTVELLKPGVLVVTPGDRDDIILAVSLAAINGVPLAGLLLTSGTL 293

Query: 300 PDPRIMELCRGALQGGLPVLSVATGSYDTATNLNRMNKEIPVDDRERAERVTEFVAGHID 359
           PDPRIM+LCRGALQ GLPVLSV+TGSY+TA  LN +NKEIP+DDRERAE +T+FVA H+D
Sbjct: 294 PDPRIMDLCRGALQAGLPVLSVSTGSYETANQLNGLNKEIPIDDRERAEIITDFVASHLD 353

Query: 360 FEWLKQRCGTPRELRLSPPAFRYQVVQRAQKAGKRIVLPEGSEPRTVQAAAICQARGIAR 419
             WL QRCGTPRE+RLSP  FRYQ++QRAQ A KRIVLPEGSEP TVQAAAICQARGIAR
Sbjct: 354 ANWLHQRCGTPREMRLSPAVFRYQLIQRAQAANKRIVLPEGSEPLTVQAAAICQARGIAR 413

Query: 420 CVLLAKPEEVQAVAQAQGIVLPEGLEIIDPDLVRQRYVEPMVELRKGKGLNAPMAEQQLE 479
           CVLLAKPE+VQAVA+AQGI LPEGLEI+DPDL+RQRYVEPMV LRK K LNAPMAEQQLE
Sbjct: 414 CVLLAKPEDVQAVARAQGIELPEGLEILDPDLIRQRYVEPMVALRKTKSLNAPMAEQQLE 473

Query: 480 DSVVLATMMLALDEVDGLVSGAIHTTASTIRPALQLIKTAPGYNLVSSVFFMLLPDQVLV 539
           D+VV+ TMMLALDEVDGLVSG IH+TA+TIRPALQLIKTAPG  LVSSVFFML P++VLV
Sbjct: 474 DTVVIGTMMLALDEVDGLVSGVIHSTANTIRPALQLIKTAPGCTLVSSVFFMLFPEEVLV 533

Query: 540 YGDCAVNPDPSASDLAEIAVQSAASAQAFGIPARVAMISYSTGDSGSGVDVDKVREATRL 599
           YGDC +NP PSAS+LAEIA+QSA SA AFGI  RVAM+SYS+G+S SG +V+KVREAT L
Sbjct: 534 YGDCIMNPHPSASELAEIALQSADSAAAFGITPRVAMLSYSSGESASGEEVEKVREATLL 593

Query: 600 AREQRPDLLIDGPLQYDAAAIASVGRQKAPNSPVAGQATVFIFPDLNTGNTTYKAVQRSA 659
           A E +  LLIDGPLQYDAAA  +V RQ APNS VAG+ATVFIFPDLNTGNTT+KAVQRSA
Sbjct: 594 AHEAQNALLIDGPLQYDAAANENVARQLAPNSQVAGRATVFIFPDLNTGNTTHKAVQRSA 653

Query: 660 DCVSVGPMLQGLRKPVNDLSRGALVEDIVYTIALTAIQA 698
           DCVS+GPMLQGLRKPVNDL RGA V+DIVYTIALTAIQA
Sbjct: 654 DCVSLGPMLQGLRKPVNDLPRGAQVDDIVYTIALTAIQA 692


Lambda     K      H
   0.319    0.136    0.388 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 1
Number of Hits to DB: 1394
Number of extensions: 52
Number of successful extensions: 3
Number of sequences better than 1.0e-02: 1
Number of HSP's gapped: 1
Number of HSP's successfully gapped: 1
Length of query: 704
Length of database: 699
Length adjustment: 39
Effective length of query: 665
Effective length of database: 660
Effective search space:   438900
Effective search space used:   438900
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.8 bits)
S2: 54 (25.4 bits)

Align candidate AO353_05065 AO353_05065 (phosphate acetyltransferase)
to HMM TIGR00651 (pta: phosphate acetyltransferase (EC 2.3.1.8))

# hmmsearch :: search profile(s) against a sequence database
# HMMER 3.3.1 (Jul 2020); http://hmmer.org/
# Copyright (C) 2020 Howard Hughes Medical Institute.
# Freely distributed under the BSD open source license.
# - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -
# query HMM file:                  ../tmp/path.carbon/TIGR00651.hmm
# target sequence database:        /tmp/gapView.9820.genome.faa
# - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -

Query:       TIGR00651  [M=304]
Accession:   TIGR00651
Description: pta: phosphate acetyltransferase
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence                                     Description
    ------- ------ -----    ------- ------ -----   ---- --  --------                                     -----------
   1.9e-117  378.0   0.0   2.6e-117  377.6   0.0    1.2  1  lcl|FitnessBrowser__pseudo3_N2E3:AO353_05065  AO353_05065 phosphate acetyltran


Domain annotation for each sequence (and alignments):
>> lcl|FitnessBrowser__pseudo3_N2E3:AO353_05065  AO353_05065 phosphate acetyltransferase
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !  377.6   0.0  2.6e-117  2.6e-117       1     304 []     389     689 ..     389     689 .. 0.98

  Alignments for each domain:
  == domain 1  score: 377.6 bits;  conditional E-value: 2.6e-117
                                     TIGR00651   1 ivlPEgseervlkAaallaekkiaekvllvnkeeevkn.kakevnlklgkvvvedpdvskdieky 64 
                                                   ivlPEgse+ +++Aaa+++ ++ia++vll++ e+++++ +a++++l  g +++ dpd+   +++y
  lcl|FitnessBrowser__pseudo3_N2E3:AO353_05065 389 IVLPEGSEPLTVQAAAICQARGIARCVLLAKPEDVQAVaRAQGIELPEG-LEILDPDLI--RQRY 450
                                                   8************************************978999998765.788899999..89** PP

                                     TIGR00651  65 verlyekrkhkGvtekeareqlrDevslaallvelgeadglvsGavsttaktlrpalqiiktleg 129
                                                   ve ++ +rk+k ++  +a++ql+D+v++++++++l+e+dglvsG  ++ta+t+rpalq+ikt++g
  lcl|FitnessBrowser__pseudo3_N2E3:AO353_05065 451 VEPMVALRKTKSLNAPMAEQQLEDTVVIGTMMLALDEVDGLVSGVIHSTANTIRPALQLIKTAPG 515
                                                   ***************************************************************** PP

                                     TIGR00651 130 vklvssvfimekeeevlvfaDCavavdPnaeeLAeiAlqsaksakslgeeepkvallsystkgsg 194
                                                     lvssvf+m  +eevlv++DC ++++P+a eLAeiAlqsa+sa ++g + p+va+lsys++ s+
  lcl|FitnessBrowser__pseudo3_N2E3:AO353_05065 516 CTLVSSVFFMLFPEEVLVYGDCIMNPHPSASELAEIALQSADSAAAFG-ITPRVAMLSYSSGESA 579
                                                   ************************************************.**************** PP

                                     TIGR00651 195 kgeevekvkeAvkilkekepdllldGelqfDaAlvekvaekkapesevagkanvfvFPdLdaGni 259
                                                   +geevekv+eA+ +++e +  ll+dG+lq+DaA  e+va++ ap+s+vag+a+vf+FPdL++Gn+
  lcl|FitnessBrowser__pseudo3_N2E3:AO353_05065 580 SGEEVEKVREATLLAHEAQNALLIDGPLQYDAAANENVARQLAPNSQVAGRATVFIFPDLNTGNT 644
                                                   ***************************************************************** PP

                                     TIGR00651 260 gYkivqRladaeaiGPilqGlakPvnDLsRGasvedivnvviita 304
                                                   + k+vqR+ad  ++GP+lqGl+kPvnDL RGa+v+div+++++ta
  lcl|FitnessBrowser__pseudo3_N2E3:AO353_05065 645 THKAVQRSADCVSLGPMLQGLRKPVNDLPRGAQVDDIVYTIALTA 689
                                                   *******************************************96 PP



Internal pipeline statistics summary:
-------------------------------------
Query model(s):                            1  (304 nodes)
Target sequences:                          1  (699 residues searched)
Passed MSV filter:                         1  (1); expected 0.0 (0.02)
Passed bias filter:                        1  (1); expected 0.0 (0.02)
Passed Vit filter:                         1  (1); expected 0.0 (0.001)
Passed Fwd filter:                         1  (1); expected 0.0 (1e-05)
Initial search space (Z):                  1  [actual number of targets]
Domain search space  (domZ):               1  [number of targets reported over threshold]
# CPU time: 0.01u 0.01s 00:00:00.02 Elapsed: 00:00:00.01
# Mc/sec: 15.35
//
[ok]

This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.

Links

Downloads

Related tools

About GapMind

Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer. Ublast hits may be split across two different proteins.

A candidate for a step is "high confidence" if either:

where "other" refers to the best ublast hit to a sequence that is not annotated as performing this step (and is not "ignored").

Otherwise, a candidate is "medium confidence" if either:

Other blast hits with at least 50% coverage are "low confidence."

Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. Gaps may be due to:

GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).

For more information, see the paper from 2019 on GapMind for amino acid biosynthesis, or view the source code.

If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know

by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory