GapMind for catabolism of small carbon sources

 

Aligments for a candidate for edd in Pseudomonas fluorescens FW300-N2E3

Align phosphogluconate dehydratase (EC 4.2.1.12) (characterized)
to candidate AO353_08345 AO353_08345 dihydroxy-acid dehydratase

Query= BRENDA::Q1PAG1
         (608 letters)



>lcl|FitnessBrowser__pseudo3_N2E3:AO353_08345 AO353_08345
           dihydroxy-acid dehydratase
          Length = 613

 Score =  215 bits (547), Expect = 5e-60
 Identities = 166/534 (31%), Positives = 260/534 (48%), Gaps = 40/534 (7%)

Query: 68  VAIVSSYNDMLSAHQPYEHFPEQIKKALREMGSVGQFAGGTPAMCDGVTQGEAGMELSLP 127
           +AI +S+   +  H   +   + + + +   G V +    T A+ DG+  G  GM  SLP
Sbjct: 37  IAIANSFTQFVPGHVHLKDLGQLVAREIERAGGVAK-EFNTIAVDDGIAMGHDGMLYSLP 95

Query: 128 SREVIALSTAVALSHNMFDAALMLGICDKIVPGLMMGALRFGHLPTIFVPGGPMPSGIS- 186
           SRE+IA S    ++ +  DA + +  CDKI PG++M ALR  ++P IFV GGPM +G + 
Sbjct: 96  SREIIADSVEYMVNAHCADAIVCISNCDKITPGMLMAALRL-NIPVIFVSGGPMEAGKTK 154

Query: 187 ----NKEKADVRQRYAEGKATREELLESEMKSYHSPGTCTFYGTANTNQLLMEVMGLHLP 242
                 +  D     A+  A+ E++ E E  +  + G+C+   TAN+   L E +GL LP
Sbjct: 155 LASHGLDLVDAMVIAADSSASDEKVAEYERSACPTCGSCSGMFTANSMNCLTEALGLALP 214

Query: 243 GASFVNPYTPLRDALTHEAAQQVTRLTK----QSGNFTPIGEIVDERSLVNSIVALHATG 298
           G          R+ L  +A + +  L K    ++        I + ++  N++    A G
Sbjct: 215 GNGSTLATHSDREQLFLQAGRTIVELCKRYYGENDESVLPRNIANFKAFENAMTLDIAMG 274

Query: 299 GSTNHTLHMPAIAQAAGIQLTWQDMADLSEVVPTLSHVYPN-GKADINHFQAAGGMAFLI 357
           GSTN  LH+ A AQ A I    +D+  LS  VP L  V PN  K  +     AGG+  ++
Sbjct: 275 GSTNTILHLLAAAQEAEIDFDLRDIDRLSRHVPQLCKVAPNIQKYHMEDVHRAGGIFSIL 334

Query: 358 RELLEAGLLHEDVNTVAGR----GLSRYTQEPFLDNG-KLVWRDGPI------------- 399
             L   GLLH D+ TV  +    G++++      D      ++ GP              
Sbjct: 335 GSLARGGLLHTDLPTVHSKTMAEGIAKWDITQTTDEAVHHFFKAGPAGIPTQTAFSQSTR 394

Query: 400 -ESLDEN----ILRPVARAFSPEGGLRVMEGNLGRG--VMKVSAVALQHQIVEAPAVVFQ 452
            E+LD++     +R V  A+S EGGL V+ GN+     V+K + V     + E  A +F+
Sbjct: 395 WETLDDDRENGCIRSVEHAYSQEGGLAVLYGNIALDGCVVKTAGVDESIHVFEGNAKIFE 454

Query: 453 DQQDLADAFKAGELEKDFVAVMRFQGPRSN-GMPELHKMTPFLGVLQDRGFKVALVTDGR 511
            Q        A E+++  + ++R++GP+   GM E+   T +L   +  G   AL+TDGR
Sbjct: 455 SQDSAVRGILADEVKEGDIVIIRYEGPKGGPGMQEMLYPTSYL-KSKGLGKACALLTDGR 513

Query: 512 MSGASGKIPAAIHVSPEAQVGGALARVRDGDIIRVDGVKGTLELKVDADEFAAR 565
            SG +  +    H SPEA  GGA+  VRDGD + +D    ++ L V  +E AAR
Sbjct: 514 FSGGTSGLSIG-HASPEAAAGGAIGLVRDGDKVLIDIPNRSINLLVSDEELAAR 566


Lambda     K      H
   0.318    0.134    0.386 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 1
Number of Hits to DB: 894
Number of extensions: 54
Number of successful extensions: 9
Number of sequences better than 1.0e-02: 1
Number of HSP's gapped: 1
Number of HSP's successfully gapped: 1
Length of query: 608
Length of database: 613
Length adjustment: 37
Effective length of query: 571
Effective length of database: 576
Effective search space:   328896
Effective search space used:   328896
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 53 (25.0 bits)

This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.

Links

Downloads

Related tools

About GapMind

Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.

A candidate for a step is "high confidence" if either:

where "other" refers to the best ublast hit to a sequence that is not annotated as performing this step (and is not "ignored").

Otherwise, a candidate is "medium confidence" if either:

Other blast hits with at least 50% coverage are "low confidence."

Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:

GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).

For more information, see the paper from 2019 on GapMind for amino acid biosynthesis, the paper from 2022 on GapMind for carbon sources, or view the source code.

If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know

by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory