Align GtsD (GLcK), component of Glucose porter, GtsABCD (characterized)
to candidate AO353_25420 AO353_25420 spermidine/putrescine ABC transporter ATP-binding protein
Query= TCDB::Q88P35 (384 letters) >FitnessBrowser__pseudo3_N2E3:AO353_25420 Length = 372 Score = 242 bits (617), Expect = 1e-68 Identities = 152/369 (41%), Positives = 206/369 (55%), Gaps = 17/369 (4%) Query: 4 LELRNVNKTYG---SGLPDTLKDIQLSIKDGEFLILVGPSGCGKSTLMNCIAGLEQITGG 60 + +R V K YG SG P LK I L I+D EF L+GPSGCGK+TL+ IAG E T G Sbjct: 12 VSIRAVRKVYGDPHSG-PVALKSIDLDIRDNEFFTLLGPSGCGKTTLLRMIAGFEFPTQG 70 Query: 61 AILIDEQDVSGMSPKDRDIAMVFQSYALYPTMSVRENIEFGLKI----RKLPQAAIDEEV 116 IL+ ++++ P R + VFQ YAL+P M++ EN+ FGL+ + L +A I E V Sbjct: 71 EILLYGENIADRPPYQRPVNTVFQHYALFPHMTIAENLAFGLESHPMGKVLSKAQIAERV 130 Query: 117 ARVAKLLQIEHLLARKPAQLSGGQQQRVAMGRALARRPKIYLFDEPLSNLDAKLRVEMRT 176 + L+Q+E R+P QLSGGQQQRVA+ RALA PK+ L DEPLS LD KLR MR Sbjct: 131 REMLALVQMERFATRRPTQLSGGQQQRVALARALAPHPKVLLLDEPLSALDLKLRQAMRE 190 Query: 177 EMKLMHQRLKTTTVYVTHDQIEAMTLGDKVAVMKDGIIQQFGTPQQIYNDPANQFVASFI 236 E+K + + T ++VTHDQ EA+T+ D++AV+ +G +QQ G P+ IY P N+FVA FI Sbjct: 191 ELKAIQAKTGITFIFVTHDQEEALTMSDRIAVLSEGEVQQVGRPEDIYERPRNRFVADFI 250 Query: 237 GSPPMNFIPVRLARQDGRLLALLDSGQARCELPLGEAADALEGREIILGIRPEQIALGAA 296 G NFI + + L +G A LP +D G + L +RPE++ L A Sbjct: 251 GE--TNFIEGTVTHVEAGLAWF--AGPAGHPLPAQPCSDVNVGATVALSVRPERLHLLPA 306 Query: 297 DGNGLPAIRAEVQVTEPTGPDLLVFVTLNQTKVCCRLAPDVACRVGDTLNLQFDPARVLL 356 + +G R + Q+ G DL V+LN RL V +L LL Sbjct: 307 NTDGALPCRIDAQIY--LGTDLQYQVSLNDGS---RLTVRTPNSVDQSLRFAVGSQAGLL 361 Query: 357 FDAANGERL 365 FD + L Sbjct: 362 FDRGSASVL 370 Lambda K H 0.320 0.137 0.391 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 360 Number of extensions: 14 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 384 Length of database: 372 Length adjustment: 30 Effective length of query: 354 Effective length of database: 342 Effective search space: 121068 Effective search space used: 121068 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 50 (23.9 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory