Align Energy-coupling factor transporter ATP-binding protein EcfA1; Short=ECF transporter A component EcfA; EC 7.-.-.- (characterized, see rationale)
to candidate AO353_12265 AO353_12265 hypothetical protein
Query= uniprot:P40735 (281 letters) >FitnessBrowser__pseudo3_N2E3:AO353_12265 Length = 274 Score = 134 bits (337), Expect = 2e-36 Identities = 83/210 (39%), Positives = 127/210 (60%), Gaps = 6/210 (2%) Query: 25 LDGVSLQVYEGEWLAIVGHNGSGKSTLARALNGLILPESGDIEVAGIQLTE---ESVWEV 81 ++ +SL + GE I+G +GSGKSTL R +N LI P SG I V G+ + + E++ E Sbjct: 46 VNDLSLSIATGEIFVIMGLSGSGKSTLVRHINRLIDPTSGVILVDGVDILQYDMEALREF 105 Query: 82 RK-KIGMVFQNPDNQFVGTTVRDDVAFGLENNGVPREEMIERVDWAVKQVNMQDFLDQEP 140 R+ KI MVFQ+ V D+VA+GL+ G ++ ER + V +Q + ++ P Sbjct: 106 RRHKISMVFQS-FGLLPHKNVLDNVAYGLKVRGESKQVCAERAQHWINTVGLQGYENKYP 164 Query: 141 HHLSGGQKQRVAIAGVIAARPDIIILDEATSMLDPIGREEVLETVRHLKEQGMATVISIT 200 H LSGG +QRV +A +AA DII++DEA S LDP+ R E+ + + L++ T++ IT Sbjct: 165 HQLSGGMRQRVGLARALAADTDIILMDEAFSALDPLIRAEMQDQLLELQQTLHKTIVFIT 224 Query: 201 HDLNEAAK-ADRIIVMNGGKKYAEGPPEEI 229 HDL+EA + +RI ++ G+ G P+EI Sbjct: 225 HDLDEAVRIGNRIAILKDGQLIQVGTPKEI 254 Lambda K H 0.316 0.135 0.383 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 186 Number of extensions: 8 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 281 Length of database: 274 Length adjustment: 25 Effective length of query: 256 Effective length of database: 249 Effective search space: 63744 Effective search space used: 63744 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory